-1000炮捕鱼机

%pdf-1.6 %�������������������������������� 76 0 obj << /t 1632023 /l 1633693 /linearized 1 /e 98138 /o 78 /h [ 1493 526 ] /n 9 >> endobj xref 76 57 0000000044 00000 n 0000002019 00000 n 0000002172 00000 n 0000002670 00000 n 0000009149 00000 n 0000009197 00000 n 0000009246 00000 n 0000009314 00000 n 0000009372 00000 n 0000009555 00000 n 0000009594 00000 n 0000056022 00000 n 0000056905 00000 n 0000057343 00000 n 0000057905 00000 n 0000058520 00000 n 0000064369 00000 n 0000064542 00000 n 0000064830 00000 n 0000064901 00000 n 0000065127 00000 n 0000065651 00000 n 0000065831 00000 n 0000066061 00000 n 0000066662 00000 n 0000066946 00000 n 0000067180 00000 n 0000068022 00000 n 0000068418 00000 n 0000068743 00000 n 0000071381 00000 n 0000071805 00000 n 0000072165 00000 n 0000076397 00000 n 0000077561 00000 n 0000077953 00000 n 0000078387 00000 n 0000078894 00000 n 0000084373 00000 n 0000085044 00000 n 0000085420 00000 n 0000085717 00000 n 0000086124 00000 n 0000090672 00000 n 0000091702 00000 n 0000092015 00000 n 0000092125 00000 n 0000092369 00000 n 0000093037 00000 n 0000093199 00000 n 0000093261 00000 n 0000093476 00000 n 0000094069 00000 n 0000094590 00000 n 0000094961 00000 n 0000097948 00000 n 0000001493 00000 n trailer << /size 133 /prev 1632014 /info 62 0 r /id [ <979b7c6948623c5f23e6a8c61103d43b> <46f4f8472fee10d31d8b7443096cead9> ] /root 77 0 r >> startxref 0 %%eof 132 0 obj << /s 284 /l 504 /filter /flatedecode /e 488 /i 520 /length 417 /t 434 >> stream x�c```b``�c`c`�d[email protected]�p���…&�nm�[���4xx��_�=�j c���r�����d��tǔ>ц�dz�e��l�:m�t��ĥn�법?�,ugui�ڭ{ږsc3o���m�'e._4k��{��u��$����؉.{g�����u�p'2c�w���l��������:��>θy}��{ �wc���@� ������ �xzr�����af��2�0�3q39�mbhc�ɠ����)c/�~&#�� ���s��yr���:0u0221�e��(���p�����a�a��#f��@d�\��x"ō=�ğ�@��a��k`�� �8e���>�� ��p�h�p̂ab'h3o�gb�b�zw �c��1�q"mɠy endstream endobj 77 0 obj << /names 75 0 r /type /catalog /pagelabels 59 0 r /openaction [ 78 0 r /fith 999 ] /metadata 74 0 r /pagemode /usenone /pages 61 0 r >> endobj 78 0 obj << /type /page /contents 79 0 r /resources << /extgstate << /gs3 80 0 r /gs4 81 0 r /gs2 82 0 r >> /colorspace << /cs1 83 0 r >> /procset [ /pdf /text /imageb /imagec /imagei ] /properties << /mc1 85 0 r >> /font << /f8 87 0 r /f6 92 0 r /f4 97 0 r /f11 100 0 r /f5 103 0 r /f1 106 0 r /f3 109 0 r /f7 114 0 r /f10 119 0 r /f9 124 0 r /f2 128 0 r >> >> /mediabox [ 0 0 595.276 793.701 ] /parent 61 0 r /rotate 0 /thumb 63 0 r /annots [ 131 0 r ] /cropbox [ 0 0 595.276 793.701 ] >> endobj 79 0 obj << /length 6405 /filter /flatedecode >> stream x��\yw�f�~ׯ��=�9"��ѹ/#�k��c�r&�i�a �`@b��>�`�����[k7�����xz�����j�~=y��r��,n�]\��rq"n�����ivz՞<{%n��է�j'o3�?_i�zon�r���������*�m3�m�jq/f�<���$k�,3�w%�%w�%2�g��h29��d��o�ć�x$�g$)se�s�c�m��� `s�ߠ%ˎ�]�4�����y*�����ko6f�; �s ��b`�4�\vzäagk5�. ��˭�����ej���wo�>��mhۮp���񐗷���׺����w� ��z2ն��&����å� ���s�m���y&nwga2���gx����y?���pgs��bv���s������x��im��0����6���6��^[&�=nq�����~�ai:��'�͓�~]2�u&r���>y��e�[3� �j�ֈ�"�΁�\�~w�ӛ�$y{���0&��yd��������e�w�<�w�<�kn~9���9��<�f�f�f9t.�h��~�-pml�z%���=x��4��c�% ��2�u���z���i�n�ш��q�����r �y�$��mja5[��?�im�(�d,����d��x�&���@`��)�/%p�6h��� v�]���h��x��r=w��z�o���fzl��y�:� �5�# z金�c%e��r�<��a�� �{��!�ercl~��ȝ�1�8��to���z[�v'� l� âq�ʮsm�1��[���~h����6pz���|�t#<��u��ј��^��t �v�o�:�`�$��xw��al���>��{�]�������g0� 7аg��,t�h�o��ƀ�"9.db$���n�@a"�u���ho5�:v�x ��[email protected]��xo}e쳺�w�8�xo�n�.0>�a-l����g���q�^�6z���ܟ�ՠ��i-]�i/ús��mod�dn�s9��åhu�[�w8 8���n�|���)m0=��jи �k�q�9��f5&��4w��\����x' 0)��a҆���2n��so�/�]��h�z��x��-w����oz<�h�܆?0^i�3\)�4��� ��e5/���,�p�*��oix|����0�i���-�r��  �� �;�5`md��y�������蠍t�x���`w�y�mlr �'���ۦ�r#�4��_��hò�v��^&�p�2�&uyl���9��%��i]��j�b6�q�&?�|�p�� �i#;��;pϫ� x���v.�[�%���#7 ��7h��g5!l��wm�܋z�xƌ��&a�uҝ1�]r�t(�b<�.�] ��a$μ� m�1��m��`�{��k�e��v|�uђ�t�-% ��y4u9�֒��c`��]��h��_���o��xp��[…�ѓ�t�ah�h�?�^>�b��k�6l�z�����~�?�o��c]�!bn��ed7�������e r���k���y|e'b����jl���k�5���k!/9fgo_���^he 9p�w�����۶)}��c�'�-y��e���f��ke1(�ͫ���dp��#.b^��� v�g���b�𲘅�^б�c��3�!�3nֈ�d��ƈh�l#��l��b ��! bo��$#�sv�<�������_����~¯��n ���c�k��y�]�� �w`�o��%��[� ���!(p4n��(�]����{�t��o�ϳ ̥�"n����j�km�{u�w�)�ț�������˒�w��'����6��s_>d�w/�1��;�[email protected]�?bi��� �q�7<ռ'ew;hj�xh��(�d /����.lry6턂��ԣeĕ7<���asw�>�d~��[����2��h� �m7?zc4�h���y�a�!�p���%�����&l\��m&����#c. ��xl��/x������bb�`8�ƥwἦm�'��qz�%����w�.t�� "����q�a��� z[8�n‰��8�.�a[���e�,�.uy�sz�bzb1�`��u��:�kqge� ;�ʎܘ�]˗j�y��r��lw77y�5!�<ჵ!?�o�] ��򔴓�?�љ�*b���`h�f���=��rݯ����x�էn����d™ ���p6�v��,o��q׀ <4�k��ˆm?d����t��j�e��q��;�"]���>��og�38e{�d ,��f��j���n����x|q����p��8�6j��j�ᅅ������o�5��b��y�x7be��*t�#8�g��`�^c�i=$���g�0ѐ$ �����5�t�����{ �\�=����ml(��%��d��щ�%��wit��g{�$8t���<��������`)�-jo8n&0&�.\��p�l>���e�3�3���{)�y��k�4��w�cpe#0r�� ���h�7���w1�x��ɤ^�c��k������'km*{�q��l��?��\���x �tt��v�bi2�!p�6gb�ko.�m"��f"#����a��2os�g5�/�r��*� f� "�f"i5u�s���y�ܗ����6ű%� �s�y�i (f�x��h�3߯}io�f�1�_��㣦sz�tm��յq-x/���>k���������s �-#�q�h۰��}�j���4�)q��= ��#�]-a�'&������ض� ��pn1�/@�� ƣ����*�v�����*�ś��:c=��h�t��ol�� �e=���'�є���b��a ���ѫ)7��t�v`'�x���r�[��pg�c���h��� �8c> ,q�t�@�����xi� {�� m�r�����u��܌'��l�[email protected]?g��h����b�>�m��[n��3�e�ke��a���%ї� ^;�u���xϧx�pi��f��1��4;��r*,t�l�y_� �"�naq1�kph�ba� ���\n�l�!ƃ1�j&�;�ξ��r��1��b>�'*c n����a�%[�e۟�aa���~v��ԣ����u��g(��4�ql�`츞�<�&���p�\ �gm�������!�<k]���m�: �h�wq�k2���>�o�]�}��#��i̬w�|fzlvi��� 3 �<�8�ex�0������?�3pm�t�����]��^���v�ū��g���x�lv/{�����@��g���j��'p��(<��3�f�0��o � ��j��^�]cư���۪���bl�i�/q�z�~fd"��$~-�0��} ���������'�����)����a��fh�f ��% '�fa�}2 u��k8��z�1���´կ1qe�݋��j�o��-����&rӓ^7w�#�g�d�shq����@e������e� jg��j�5dx�"b�v�����p � |���rn�-:�'��$% �e�v 2 ��cl�w�? ���o�����-u��fb�(������s�(n�'����y�[o���r=:�q�d�� w� i�������o�c�i�{1���1�*u�\#�����<nt�����e>�"y=�oabj5�u<�bp��m �`� ou���t���a��_�ޭ^�h��=���δ�_��pu�ţzh�_����zk��n^��j���ϲ��g��s( �� ��f�\0vd�^��m��h"���,��`�gc1/���!�׎4.�s�**;�����6v*����>��a�2���-䄻���_��%踅^��s3��y�p�]��������g-�a���law�j2�4�ji1b|aє_�}z�_����~�zc��@a��ɋ�f�h�:�vth� yk;({�g%$o"g�d�@�ʨ�n�&�7'`q1��1�!��5����f���6�ɕ��[email protected]���vz_�#v���d��d� 8-��7um����)�m�ǀ}1��=ohq�x.xt��mӆb �]� 6�.ht,˶��8pf_�j��ᎃot���p-�gs�y=�쨬�?��mxgd�s,^pq��9p0�pn�\�#�l�[a�a5#�ۅ5~�v�|jc�=~o��o`������g(�r1���9nk�4���z��e٥դk�y�ҿ��8��e!�3��nt�b&���k��w'�e��(��u��!�m�?�6�� �7jgh��Ԭԯ�u�� �6&)��z�fc�wٌbm�=����!�b^�v�!i��(�$zp�d/�t� �ŭ�i�y��z "����xɚ����fϖ��7o_�8���0ށf�k6�s|� �_e�z�wb^����—�#�!��g�u[�緯�s�� ���4� �z�b_l)ü��v}�-�‰c�sr�8l���5�j���e���;�˵ǯ endstream endobj 80 0 obj << /type /extgstate /op true >> endobj 81 0 obj << /type /extgstate /op false >> endobj 82 0 obj << /sm 0.002 /type /extgstate /sa false /op true >> endobj 83 0 obj [ /separation /black /devicecmyk 84 0 r ] endobj 84 0 obj << /functiontype 0 /size [ 2 ] /bitspersample 8 /domain [ 0 1 ] /decode [ 0 0 0 0 0 0 0 1 ] /order 1 /range [ 0 0 0 0 0 0 0 1 ] /length 8 >> stream ���� endstream endobj 85 0 obj << /metadata 86 0 r >> endobj 86 0 obj << /length 46344 /subtype /xml /type /metadata >> stream application/postscript print 2016-11-22t16:54:51 05:30 2016-11-22t16:54:51 05:30 2016-11-22t16:54:51 05:30 adobe illustrator cs6 (windows) 256 256 jpeg /9j/4aaqskzjrgabageasabiaad/7qasughvdg9zag9widmumaa4qklna 0aaaaaabaasaaaaaea aqbiaaaaaqab/ 4adkfkb2jlagtaaaaaaf/baiqabgqebauebgufbgkgbqyjcwggbggldaokcwok dbamdawmdawqda4pea8odbmtfbqtexwbgxschx8fhx8fhx8fhwehbwcnda0yebayghurfrofhx8f hx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8fhx8f/8aaeqgbaaeaawer aairaqmraf/eaaiaaaahaqebaqeaaaaaaaaaaaqfawigaqahcakkcweaagidaqebaqeaaaaaaaaa aqacawqfbgcicqoleaacaqmdagqcbgcdbaiganmbagmrbaafirixqvege2eicyeumpghbxwxqipb uthhmxzi8crygvelqzrtkqkyy3pcnuqnk6oznhduzhtd0uiijomjchgzhjrfrqs0vtnvkbry4/pe 1ot0zxwflaw1xdxl9wz2hpamtsbw5vy3r1dnd4exp7fh1 f3oehyahiimki4ynjo ck5svlpeymz qbnj2en5kjpkwmp6ipqqusra6voraaicaqidbquebqyecamdbqeaahedbcesmuefurnhigzxgzey obhwfmhr4sncfvjicvezjdrdghasuywiy7lcb3psnejegxdukwgjchgzjjzfgidkdfu38qozwygp 0 pzhjsktmtu5prldywvpbxf1ex1rlzmdoawprbg1ub2r1dnd4exp7fh1 f3oehyahiimki4ynjo dljwwl5izmpucnz6fkqokpaanqkmqq6ytrq v/aaawdaqaceqmrad8a9u4q7fxyq7fxyq7fxyq7 fxyq7fupeajy2sc7udiv7c2aj q6n6mqy54yxcyagkdmx2 /mpsyaraxsxtdof7td9lff/wuann2 7ij9imvsh4 ducwsk7/mpwzsrbxxw69iaxb72npwzwze3c0vpaj9v4 ta5ilu/mjzbp9u/lff5d6 f/eooym 0drlnm/db7mbnlvqml7esmsk8jn/acny/roy0s0zzjpxy2vhk0oxvwjvbyi1jnkq/wcs 7d9ryyoay5ej4pso6dzr5gg xfymn859t/iflmmhaoojymfjv97itl3prafmhrmraui4rhe5ikn9 6mn4znyu3c0fqal9n4 tmzintj yekzuw6iktwpu/wb4g lfi/4xnnh7dxs ogp2j8fbmmwzfz6j y3qc7sdjl78gbi y6j6c22lpdilgqw0ehkimts7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fx yq7fus1fzhpwlkfrmtzv2ye kq/r2 nmpva/fghqo/cobguwgfar5 1w6jszas4feffif9kdh9az nnt23lntd0d7wiwunkxqwaaaqyto0kjfadywy/mnnpkzkbjstvrmih2kuxv2kuxv2kuxv2kuxv2k r4ppozbjc7ryl9l0jvh8imlgzibboptkuleftvtsevalyhxpwyd/agq2p0jnxpu28snp sfa2xyk c2a6r5j0rvvh1awk37ud/dipo7/rnr6xx4s49j37jzb4zbtpmxk7fxyq7fxyq7fxyq7fxyq7fxyq 7fxyq7fvk6u7a0gae5kwkfbvny0gqyzywjxsnbbnmd17z9czlonlbgh6g4p943 r/l v5zzgt7bl l04vso/r xonl7mjo7uxd2lmxqze1jpuc0jjjstk3ah2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kr kd0yojfwu1vgaeh2oeeg2est0hz9cwfynubnh6c4h94v t/n v55vtf23kppy od/x9rddl3s8tb u2u4fntpflhcvv1nrnt48szx4omw3g2q5nlsvdirsvdirsvdirsvdirsvdiqw65r9jpfv6lweurf 3ucn4mp8b4nmpwa2gcny59b3sztaezazrt/q0/qxl/ad 7hx7cd2hj75xur1utpk5hbu6bxztjs7 mrg7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fux0bxb/aem49s2eqe/viw ww9x4 ze k1utbk4nbu6fngzd03q9fsdxt/utzxlwnqwn9pd/abhvnzapwwzxuppqo5yozbtlmxk7fxyq7fxy q7fxyq7fxyqk/mpzhbanbakcw6lb9ggv/dn4kpxzx6/xx08e r5bhofc8vvr66vrl7m6kmkrncns padsbnf5s0skjkrslxcbq vidirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdiqisb6 6sbllm1kmcqhyjupajudluhnlhisiaisdt1dy55jttztiqbfdraetdx/aizfft gdponfhur7pdm hlhpitjngzdirsvdirsvdirsvs3x9ct9istcsffk3wwrv3dv6dvmhrdzhbdippoo9jovb5tfx1zf xul1cuxlknsew8apadohzzpzjgujzlhk2h8qq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxy q7fxyq7fxyq7fury31zy3ud1bouljnqex8qfehlcoawoqle0qkgnq2ga5b6vyi4j gvfhnirujf0 pbo40wsjnhxdn1hc5kjweyzmzoxv2kuxv2kqv3dqwltjczsehius7hwgqy5iwizs5bbnpjdd1m41 a/e5kqehwwx9ltspn45wmt1cs qyplp5bxjyspdmiwdirsvdirsvdirsvdirsvdirsvdirsvdirs vdirsvdirsvdirsvdirsvdiqy6frnxpn lzhuofhmj7mncfpwzl0wrlgycq5dfmm4sovwrs6gu7a o5gypdkozghgc7vfkjoilhkxlbtvyaxyq7fxyq8 8/a8z7kaxa37ma1ucp2pp5f9j v5zyvbet4p efhlhn7/anjj5z9gizogh2kuxv2kuxv2kq0vnetixhgkkqdwrgyd6qmsjiniwaspcmipeegh2i6j k0nyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fwx qdemfydlnb9zoa25p7mn8v y/x 883/agjregxhs5s5e/8aa34p9hoodu5dsvdiqwey9xxstklua/vj8ec mjdpu65h6/vdbimuvie9 jovb5i7s7s7kszelmpuk9tnbkkmy4a3ah2kuxv2kuxvovkokw6nrkqzjlbehmlt ykqapvyzsey9 km2apfsbzbmcbl1vesnaikerrrvuuahsbnbgacg5bevp i2z2b1onalxcyizgkc0yhd/cejnf23p inh4ohqhpzacsdree5yjjoxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxvcjsjq6eqykfw hueddhbinhl1vy5q66rpuvzx98pgnxwkxr9/xo80gqgfejder97mqlytpmxk7fxm/n7vfrwqizq/ ubmupvi27fckdoq7b1phl4byh97jzzwayvmlaxyq7fxyq7fxyqnplpv4tl1hj59ojvmurdeiyg1 gqm2hzmqghnxs k7fsxyovvypopo1kidzi2fvdsccpyjo3jisfg2hlyh59121fidmhkek8rkzwpq evtyofcsbtmh7b1sedwomyefk05z7uwdowcz2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv 2kuxvlhkhvta6qbnz 5vbqe0i7r94qm3xymp4mvaeu/vbsuqnpsm69yupqn4llyz3b/zhrnp4kdy fsdsqz5rjgznoee0lentsyttpnieukjf3bxzjunppzymisezcirmih2kuxv2kuxv2kuxvcskighw kg9qcrkhijklbkuoxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxvfdljdmk0z4yrs hrvblnqclcriqrzcq9l068s9syltpszir08crupoo2ehymoyqex1dmg2ly7 yd96okxwqmjxum48 uj i/wddcc1pbubhxcp84/ypwgrmdnnoci4zsvdirsvdirsvdiqrawz3v1dbrkcsery0ldaxiuvp xbflmwmzkijmtxzsbbjf vc63/v 2/4kt/mjnv8aydm74/m/qbfbkva75cvtf9d608t vy4ekwno fk15kv8anmfrnbpt1xehi7vl4mjqmuqzbyoxv2ksxspy8 t2nvdfpdh68ss8prrtmoaleyrsudbh 7c44rlx1xah6e/4t4w2oav8a8qz/ao1l/wakf vmw/6hv6f x/anwpn3/ks/ 1l/yr/6 y/6hv6f x/avgebv vz/wday/5i/wdxzh/q9/t/anj 1fa83f8aks/ 1l/yr/6 y/6hv6f x/avgea1/wat jb9jufb5xefqc5e zx6t z9qpa80dc/l5rcyjhegcdldfw/4yafjmnk7czdkyyqcjsk 0nu7a0u7 z4r0dmphpyyfcfvzwztlkxfxehrmsoaeyhi7fxyq7fxyq7fxyq7fxyq9g/ly 9bszbvjvrwtyecs fep g5z13ywbixgp80/yfwxjwnzivzduzlrmdud8nvear/losx/cmazt3lxzhh apv8awggy7swz snlsvdirsvdirsvdiqo0l/jt6f8a8xmp/jwzk6l h/wj97khmpys9ac1g/5mf8ast/57f8amvob 9of4p879drn6mhzmnhdirsvexaf/xxnp/wcyah/k2m9a0x9zd rh7nnhycozjzoxv2kuxv2kuxvp 0r1koozgfguioi9wcbaioqxnwvienxyasxpz3hxip7o/nf2fo 7nnq xcetehpl9n49zvledyybq omxunxjt7uixydchqghip7joxz6eekxdmuxhmsoafyhi7fxyq7fxyq7fxyqyn8vlsxazjbk/dcre af5sempwrm77cy8oyx/nd7vww7cd0q80t v5gv360lkf8i/g/wcncwe0z8womfovlswmfuurzcyo xv2kuxv2kuxv2ko7qv8ajt6f/waxmp8aycgzoi/vof1o/eyhzd2lpqhnyp8amz/0rf8ant/zlzm/ ah d/o/q0z jb85px3yq7fxswhf8ctt/apmgh/5njpqnf/cw/qx 5zycggfo3/kmxv8azy/5opmn 2v8a4tl4f7omcv0vk84hxhyq7fvwk7uoidfm8zhtixh6jlkcso8iqm00s/n/mg1i43bsr3wb95x6 w l8czmxamoh/ffv3zjjimo0j8wrsdli1gl6s529zkthx3h2l/hn1pe3ysnzbw frtjmhvlsckci ljgwdhfvdtuehucm30zaixybkjq2kwwqwhtrpajqjj7sn4qco1wlhmjwy/syyic8q1nr7rsr1rw4 fe8cg y69im4fv6wwcfdl 1xjroohmzi7fxyq7fxyq7fu08rz h5gsh6vlcf8jpg/wcnszezp8oo gfovnszgfuedeygw8nkpv5hb72jzgzsuzpesxpnrytdsvdirsvdirsvdiqo0l/jt6f8a8xmp/jwz k6l h/wj97khmpys9ac1g/5mf8ast/57f8amvob9of4p879drn6mhzmnhdirsvexaf/xxnp/wcy ah/k2m9a0x9zd rh7nnhycb87f8akmxv/pl/ajopmn2v/i0vh/ugxy/s8rzihedirsvdirsvdiqf ewfnfzpm6xseywdn95f141/at39u bps7tgwcvhehd knkj17nqemsu0ssxmhjkazhg4io4iztiy egcorctkvnghpq2mvgoh1qkr2zf5xdfk3tmlthrjpjr icvx5sjxspjycpiiorsqetc4yhw2scux v2kuxv2kq1liyrycqdukrvuyhlmmqmd3ejhnrytdsvdirsvdirsvdirsvr2hf8dvt/8amjh/5odm nrf30p60fvzq5h7fnodmsh/mz/pw/wdpb/mxnn 0p8h d hoz9gd5ztjuxv2kvytc/44mn/8w0p/ acbgegal 5h/vj9zmw5ba dv uyvf ex/j1mxu1/8wl8p90gox6xlecq4jsvdirsvdirsvdirppy 81hpipdllapihq29f5sfjx6ca/fnt9haqwcr6bj9lkyzdgaz0te8v876allxjhquiuh6y himjj/ ailf6c4vtjt hnjhkw/63fyxosfzvntsvdirsvdirsvdirsvdirsvdirsvdirsvr2hf8dvt/apmj h/5odmnrf30p60fvzq5h7fnodmsh/mz/akvv/pb/ajl5zftd/b/nfoam/rg c047svdir2lqv oj p/8azdq/8mxnogi/uyf1y/c5soqqpnb/ajri9/55f8nuzg7x/wawl8p90gox6xlecq4jsvdirsvd irsvdiqz wrw2mu2u1al6gr/djj8b/xmz2fl8ppe f37m4gi9dzvxmyh zfqg0 1uqfffkyz8pfr tm0hb o8czdxr5/2noybpps5vxnyq7fxyq7fxyqrxszivj4z1sr1 5imszrqzhcsk81hk0oxv2k uxv2kuxv2ko7qv8ajt6f/waxmp8aycgzoi/vof1o/eyhzd2lpqhnyp8amz/0rf8ant/zlzm/ah d /o/q0z jb85px3yq7fxswhf8ctt/apmgh/5njpqnf/cw/qx 5zycggfo3/kmxv8azy/5opmn2v8a 4tl4f7omcv0vk84hxhyq7fxyq7fxyq7fvymudxx7skefmyqanpe2qwzqw6mar9oejg2lc5ifpufl y3cn/i0bf8of/jms7zjenplx3tex6xl2cu4jsvdirsvdiqtzrmw8gjhv5ex72ayzdg5gd5crzr3m id0pmf nsspf/kz8f/g2zpamohuthnfz3zthqkv5hmhyq7fxyq7fxyq7fudox/hb0/8a5iyf tgz j0x99d th72uoyexz6a5rb/zm/6vv/pb/mxnn 0p8h d hoz9gd5ztjuxv2kvytc/wcojp//addq /wdjsz6bov7mh9wp3obdked52/5ri9/55f8aj1mxu1/8wl8p90gox6xlecq4jsvdirsvdirsvdir sve3rqvjrt1uah6bnperqpz0k88mb5zux/mywp8akyp/hmt7yp8ag0vh94a8v0vlm4lxhyq7fxyq 7fu08rwev5gse60ld/8aiv4/ nczezocwogpo/luzgpue1/mo0mwsx3ahw3eqjp uhkn8kzndu4u hmjfzh934dpmn2lzpgl2kuxv2kuxv2kuxvhaf/x29p8a ymh/k4mydf/fq/rr 9ldmhswegoawf8 zp8apw/89v8amxnn 0p8h d hoz9gd5ztjuxv2kvytc/44mn/wdmnd/ybgegal 5h/vj9zmw5ba dv8algl3/nl/ydtmbtf/abaxw/3qy5fpev5xdioxv2kuxv2kuxv2kozsly3wqwlubx1jub xiv/d mjs4 plgpeqyill2tpqxnyt ylwi9fjhr8u0yinsojp40zsduzrcb3yasx2eczyliuxv2kuxv2ks p/ly0musyxbhw28rip8aloqo/cubvslfxzjl apv/bbsi3t38w7h1tjiulfwtznz4jj8j/4bjmz7 dw8wis/mn7d azzdz5znium7fxyq7fxyq7fxyqjtc/47en/8xmp/accgzoi/vof1o/eyhzd2lpqh nyp zn/st/57f8y85v2h/g/zv0ngfowfoacd2kuxv7fox/he0/8a5hof tyz0drf3mp6sfuc2hii hzt/yjf7/wa8v tqzjdr/wcls h 6dhl9lyvoicr2kuxv2kuxv2kuxvlv5eaw02oyx7j91bkvjpj i4p c1 /n72fp lich5r 8/sbsmd7eh51jkvo/ze1atandzqarapv/8axkoaf8cbnj9u5 liid e faxgzhemj5oml2kuxv2kuxv6n xlj6oky3tcjxumx8uj ef8nyzruwspdimv5x wfguthgzitrs0 vbge0f7mymlfakbh6dvm2z4hkgyhqg0ixtxqaksgz4zbxkjyo6 dkaez57ojisdzdhfzkuoxv2ku xv2kuxvhaf/x29p/aoymh/k4mydf/fq/rr 9ldmhswegoawf8zp lb/z2/5l5zftd/b/nfoam/rg c047svdir2lqv8ajiaf/waw0p8aybgegal 5h/vj9zmw5ba dv uyvf ex/acdtmbtf/fpfd/db jl l5xneoi7fxyq7fxyq7fuvpum3eo3awtqnkrup7kvdmpydl9pp55pimruyjekvwti0u30ywis4 d1qvz 7merh553wl08comqj0cumafl9s1cdt7ga7mpwrlwnieyj5nbjajphfazpijkafvhry6lu7 qw5mnzjmlt8ya5wgxizymjzlhe2o5wh2kuxv2kr4ypjpkhjhksrgil4sxobkormiaozshsunwawv jbaj9mffsviqnz9j3z0lbigoagogc0chsiy1lzfz9prtdvf4g/c3gqfardm 8uoch23pudlxjlp7 3gyxo2xfnk0uxv2kuxv2kuxvhaf/x29p/wcymh/k4mydf/fq/rr 9ldmhswegoawf8zp lb/am9v zec37q/wf536gjp0ypnnoo7fxyq9i0l/jiaf/zdq/8ajsz6bov7mh9wp3obdked52/5ri9/55f8 nuzg7x/xaxw/3qy5fpev5xdioxv2kuxvsakgavj2agfu/wbi8laxfsrsobs3pwsuuyj/acu6/ftn ppeym2xcjhj5/qbi4ixooj6hyatb lap8tu9svt3cjxp8m6rsaogcnrhx73jjebho6rozuwvfblm tqadqscysqbz5mnmxm/zkdvurbbkiwgpwdubdozh6s43tttdx5cmfoh2 f6nfyttjualqdirsvdi rsvzr5b0o3wqm8cfubmvhvi2y/cknn12jpuplxnld727fgzb0jovcl2kpz5j0hdv0qw2p hxwhw kubff0zd1 lgfey9ey97gcbdyr0zhzhbvljdkeoi6jodiinfw1ubdsvdirsvdiqo0l/jt6f/amxm p/jwzk6l h/wj97khmpys9ac1g/5mf9k3/nt/zlzm/ah d/adv0ngfowfoacd2kuxv7fox/abxn p/5hof8ak2m9a0x9zd rh7nnhyctf2ntf2klpcqxgkpzuej7lbhupczznwxywmjcikixsuf4f8t/ 8s7f8jh/ak5gfynp 77sw8klv8c w/8alnb/ajgp/xh rtp3fav8klv8c w/ wdv rj/ancf5g0/ d9pxwor4vjplqm1 qcj/ajtyh8ovmlhsjtd h7svhrto00vtrp8a3ltoot/migh6t1zmxafhj mi dmraroxjqmo6ryadb615mi1/zhvmpgqjc5rqntjwxuzpepac3nxmtzdd6stbcdbyg/3dfienqur ros7q7uln9i9mpv97jtywx/nu1oxv2kuxv2krkrnduqfmygko6knomibjojet xnixstkitqfvj8 c58zgg/3dm7zqauymqj15n3uzcnbm8zgtsvdirz7z9ojgurqkc/uzzs4a/zk/m/2x6/nnk9t6lhl 4seuufv/aguplh1yhmgahyq7fxyq7fuxpe0cgq2u0rcyop4nkbwvxbj29sv0sxhlenkjd72utu9n /wayew/ w5f bf8a5pzsv5v0/wdp 9yvej3st8 axpuo/ufqu4m9l1fuogfoxcnudwoaptrvy8vb wg6v9dtlkdvmtzrnlsvdir03spnwgqavzqy3irlfbeki8x2zuai2hjnzaxtlbhfegw4io/ucqoqu i/8aghlv/lux/gx/aoacv/lxt/z/al2xir73f4w8t/8alcv/aal/apnop8q6f f96 jhvd/jdy3/ amty/wdav/ztj/kun/n/ahr4ke93 mplf/lcv/av/wa04/yrp/5/3r4ke9pvoplpru3q09kkp6lw htxtfz/sp6l8spegrn8wdcib9es3dduk8r97kfqzhyduyi8rl pnicwshufzd1scflojlvt 2f3j /eqf/dnxn7dyy2gbh7s1nmejglm5ulmuzxejsyt1dysfxztzmkpm5gy1e2pzbdsvdirsvdirsvzf 5b0ez3j1sdf3mbpbg/tsfzf7h9fyzf8aymi4pelllhl7/wbjfih1eg51tkoxv2kuxvsu7wc7tpla decmqlxu bygxhgctgxioit5lrujxgk3720lsh kgtsydj8/hoe1uklgygj5dpmojonflsxgdsvd irsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvthqtgn1bueto6rgpinl7in c/pwzl0wklnyci5dfim4rsvwrs1gtlao2gxhdeovfhgm7vfjjcijhkhlapvyaxyq7fxyq7fut1/q 7fv7e28nwyr8uetn0b h75h63rxzw4tz6huyzjyeu31jc2n1ja3kfjyzqjsfajxbzh82gworjiuq 4zfifkkoxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxv2kuxvewnjc311ha2yf5zd qdspenway3dhlkkixfkpat6togh2 kwit4/ilb4p5abu39b2zunfo44ici59t3uzcnbmszgtsvdi rsvdirsvdiqt y/lltrnsasi7qmh0zqf8k3ipzx6/qr1ee6q5fhohe8vvrg6sbl7a6jmcqhchupe hudnf5smscjgqohxckq vidirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdiqisbg6v rlla1jmkrnydspensbluhdljiriljsbb1hy55cttgtiarjdsaetnt/hv/wano10ggjp498jzp46o xchcm z7n2kuxv2kuxv2kuxv2kuxvldc0cx1e39o4hgva lov2kp8r7zh6zrqzxqxpoe5jkalzlw dc1dsz/tuurgx/dtr9hx7hx9s43v6ljgluht39c4soejdmiwdirsvdirsvdirsvdirsvdirsvdir svdirsvdirsvdiqy6noooatp6dsli1p72ztkqe58fbmvsaljnlurt1pqm4wjem6hofjpfv6duour u9wdvtof4d2zsthooyi1hn1pe5uyajlmyydirsvdirsvdirsvdirsvdirsvurq0trubolmnzyx2z gfrkmmkm48mhyqrba9e8g3mhkfsyz4eptz/el/q/zfr ecxrexjr9wl1du6/taj4u5ito6mudsrk ampfcd7jncqqalstwidirsvdirsvdirsvdirsvdirsvdirsvdiq5ed2cipzmnfucpj9hhajnblld b8g3m/gfvcyieotx/en/rfy/r wb7rdisl6svphd1/y3qxd7plw0trsbylanyou2vffbnt48uyr4 yig3guq5nlsvdirsvdirsvdirsvdirsvdirsvdirsvszv/lmlaqp sxum7tprzb9pf6cw9vomwce ob945szqbyvqvkhvlul7ii8h/lhwyae6ny/qfoznnt2jlhvd1j7wiwijkxqwgagqxzi0ci/arwvy fmhnpkbiaiotvlmih2kuxv2kuxv2kuxv2kuxv2kr4ozppbhcjssn9lebzj8gmlgbkaasppk2leqd uuir3hfnd3u/fir/qjyfsc3gm7eyz3n6r9rbhetzzrppl3stkufvoqy953 kq/t2 joj0ugxyppg /f1b4watlmxk7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fxyq7fupeady3qclubjl7c1bi r6 j6mqy4izbuwcgghmx2 /lzsjqtayywrhov8aeipob4v gzu5uwsuvpjj9v4 bwcisk6/lzwyitbj fcl2fsjfcwp oazl2fmh0ks z8fnroepvp5x8wqfbsjtt qep/xdlmdps7ur5wpw3 5gys7kfjzx kzpjbih8grh szjswzhmefbjrumrq7fveoyvjdsocrz4kjh9qyyogz5an4joo2dyv5gnpwweo/4y d0/ j8cyydnaixkb o33shjl3jta/l3rmhbnkit17ipdvuap oz2pslmfqij9rmysnlj xmkq0a6 lkumhvf7td9c/f/w2bpd2fij9rmvs/hzbbhdirpt7gyj4wkcqr34kat8z1p05tswcgmvaangahje zal2kuxv2kuxv2kuxv2kuxv2kv8a/9k= xmp.iid:25e4d20a9eb0e611a53bc7a0ab27eac7 xmp.did:25e4d20a9eb0e611a53bc7a0ab27eac7 uuid:5d20892493bfdb11914a8590d31508c8 proof:pdf xmp.iid:23e4d20a9eb0e611a53bc7a0ab27eac7 xmp.did:23e4d20a9eb0e611a53bc7a0ab27eac7 uuid:5d20892493bfdb11914a8590d31508c8 proof:pdf saved xmp.iid:23e4d20a9eb0e611a53bc7a0ab27eac7 2016-11-22t16:52:05 05:30 adobe illustrator cs6 (windows) / converted from application/postscript to application/vnd.adobe.illustrator saved xmp.iid:25e4d20a9eb0e611a53bc7a0ab27eac7 2016-11-22t16:54:51 05:30 adobe illustrator cs6 (windows) / print false false 1 49.606689 70.157471 picas cyan yellow default swatch group 0 white rgb process 255 255 255 black rgb process 35 31 32 cmyk red rgb process 237 28 36 cmyk yellow rgb process 255 242 0 cmyk green rgb process 0 166 81 cmyk cyan rgb process 0 174 239 cmyk blue rgb process 46 49 146 cmyk magenta rgb process 236 0 140 c=15 m=100 y=90 k=10 rgb process 190 30 45 c=0 m=90 y=85 k=0 rgb process 239 65 54 c=0 m=80 y=95 k=0 rgb process 241 90 41 c=0 m=50 y=100 k=0 rgb process 247 148 30 c=0 m=35 y=85 k=0 rgb process 251 176 64 c=5 m=0 y=90 k=0 rgb process 249 237 50 c=20 m=0 y=100 k=0 rgb process 215 223 35 c=50 m=0 y=100 k=0 rgb process 141 198 63 c=75 m=0 y=100 k=0 rgb process 57 181 74 c=85 m=10 y=100 k=10 rgb process 0 148 68 c=90 m=30 y=95 k=30 rgb process 0 104 56 c=75 m=0 y=75 k=0 rgb process 43 182 115 c=80 m=10 y=45 k=0 rgb process 0 167 157 c=70 m=15 y=0 k=0 rgb process 39 170 225 c=85 m=50 y=0 k=0 rgb process 28 117 188 c=100 m=95 y=5 k=0 rgb process 43 57 144 c=100 m=100 y=25 k=25 rgb process 38 34 98 c=75 m=100 y=0 k=0 rgb process 102 45 145 c=50 m=100 y=0 k=0 rgb process 146 39 143 c=35 m=100 y=35 k=10 rgb process 158 31 99 c=10 m=100 y=50 k=0 rgb process 218 28 92 c=0 m=95 y=20 k=0 rgb process 238 42 123 c=25 m=25 y=40 k=0 rgb process 194 181 155 c=40 m=45 y=50 k=5 rgb process 155 133 121 c=50 m=50 y=60 k=25 rgb process 114 102 88 c=55 m=60 y=65 k=40 rgb process 89 74 66 c=25 m=40 y=65 k=0 rgb process 196 154 108 c=30 m=50 y=75 k=10 rgb process 169 124 80 c=35 m=60 y=80 k=25 rgb process 139 94 60 c=40 m=65 y=90 k=35 rgb process 117 76 41 c=40 m=70 y=100 k=50 rgb process 96 57 19 c=50 m=70 y=80 k=70 rgb process 60 36 21 grays 1 c=0 m=0 y=0 k=100 rgb process 35 31 32 c=0 m=0 y=0 k=90 rgb process 65 64 66 c=0 m=0 y=0 k=80 rgb process 88 89 91 c=0 m=0 y=0 k=70 rgb process 109 110 113 c=0 m=0 y=0 k=60 rgb process 128 130 133 c=0 m=0 y=0 k=50 rgb process 147 149 152 c=0 m=0 y=0 k=40 rgb process 167 169 172 c=0 m=0 y=0 k=30 rgb process 188 190 192 c=0 m=0 y=0 k=20 rgb process 209 211 212 c=0 m=0 y=0 k=10 rgb process 230 231 232 c=0 m=0 y=0 k=5 rgb process 241 242 242 brights 1 c=0 m=100 y=100 k=0 rgb process 237 28 36 c=0 m=75 y=100 k=0 rgb process 242 101 34 c=0 m=10 y=95 k=0 rgb process 255 222 23 c=85 m=10 y=100 k=0 rgb process 0 161 75 c=100 m=90 y=0 k=0 rgb process 33 64 154 c=60 m=90 y=0 k=0 rgb process 127 63 152 adobe pdf library 10.01 endstream endobj 87 0 obj << /type /font /subtype /type1 /tounicode 88 0 r /encoding 89 0 r /fontdescriptor 90 0 r /basefont /bmhpmg scalapro-regular /lastchar 176 /widths [ 500 500 500 500 500 500 500 500 500 500 631 570 889 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 850 581 581 309 309 581 581 250 275 250 409 581 581 581 581 581 581 581 581 581 581 250 250 581 581 581 581 1000 672 635 667 740 581 571 745 838 372 364 653 531 901 737 743 600 759 654 562 600 780 661 942 660 612 668 250 581 250 581 500 581 457 526 430 532 461 323 507 568 282 274 508 267 883 581 505 538 521 377 421 299 570 442 706 437 443 469 581 581 581 581 581 581 581 581 581 581 500 581 581 581 581 581 581 581 409 409 581 250 581 581 583 582 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 581 333 ] /firstchar 2 >> endobj 88 0 obj << /length 365 /filter /flatedecode >> stream h�t�oo�0 ��| ;�@ђ���v�z����l�4b��~6f�v�0��{r��q���� 'h;�x��75^: ���3��5�m_9���6n�m;@q�;�'��!{t��}g/�:g�t8]���� �l�p�\���g��_�|sz�����u}e/��%�*m��_m�hݚ��ҫt�k�t8f^ ���9�0��9s%�f��fc|�*�����<��zzt5�s�i�̭�8��"�ϕ0�rj�i�)�*��(� r��d\��)���k�m-zzg����k�'*$,�j!��x#���"[�p��e�d�f�a�ċ��r߱�zo럯լe�og�~���x��? 5�� endstream endobj 89 0 obj << /differences [ 2 /two.tf /zero.tf /one.tf /three.tf /five.tf /eight.tf /seven.tf /nine.tf /six.tf /four.tf /unifb00 /uni00b5 /unifb03 37 /percent 40 /parenleft /parenright 44 /comma /hyphen /period /slash 58 /colon /semicolon 64 /at /a /b /c /d /e /f /g /h /i /j /k /l /m /n /o /p /q /r /s /t /u /v /w /x /y /z /bracketleft 93 /bracketright 95 /underscore 97 /a /b /c /d /e /f /g /h /i /j /k /l /m /n /o /p /q /r /s /t /u /v /w /x /y /z 133 /endash 141 /quotedblleft /quotedblright 144 /quoteright 147 /fi /fl 176 /degree ] /type /encoding >> endobj 90 0 obj << /type /fontdescriptor /flags 6 /stemv 76 /fontname /bmhpmg scalapro-regular /xheight 460 /fontbbox [ -64 -256 1200 921 ] /italicangle 0 /descent -260 /capheight 699 /fontfile3 91 0 r /ascent 749 /stemh 37 /charset (/t/h/e/m/i/c/r/o/a/d/two.tf/zero.tf/a/i/d/s/y/t/m/g/n/f/p/l/u/hyphen/fi/comma/period/one.tf/three.tf/b/n/x/parenleft/c/o/s/parenright/r/f/p/g/h/x/v/w/five.tf/eight.tf/seven.tf/nine.tf/six.tf/four.tf/e/w/fl/u/q/k/z/q/bracketleft/endash/bracketright/semicolon/unifb00/b/j/colon/l/z/at/quotedblleft/quotedblright/slash/v/underscore/uni00b5/quoteright/degree/j/k/percent/unifb03/y) >> endobj 91 0 obj << /length 5758 /subtype /type1c /filter /flatedecode >> stream hޜxx���u�tx �n� �%�; ��)" ��e:,����hl`�(*�b�j����x�`7�$&��|�9��y �{����>�ó��=�{����}g��a�phl�h����-�?��y=�58$!�_�����b~�?y��e~���c*]���ꏘi#åbjl��x��;��t\���6��&˴ctt0��^���r��>�q���(4 a�ѳ)&k�mv%��c�֛�g�x�gć�ȃeq��q&l���m����mb"��� �����l�eg�ǚ$`9�hi��_l�<2��)z���! h�@w�@_$`��1��b ��g b��a�@pb ܮ'x�  �<�f u�n�׃�a~"{q��g[�l�b�b�wi}ҟ�!�h �l���u��`np����� ��4�̐�c���p��c���^���������b_�qq۰i���k�g?3b��e#zg�6���w�yc=c��o��;]e�c�ͨn���qy�c�sgsw3:���~a��_���)';4?�| �@sc��l^v6\h�i f�k�<�.~�/e�u����t:��c){��>�w�z��ŷ�y�!��<��b/�s�7��^z����@��:v��b�:��w� v<|"���c)v�ty���,lz�ϭ��i�mmi��^ ��t�����'��&��ȭ� ��t���� �@�h2z������[mk�`���&���ou�[�z)<��}�-�t�'�l8r�i4c�gc��b�c#�'��q�,���¥n���h�(���u��/�7��b.� ��ka�o�fl�6��-c��������-* (��h��6(��e�y���7�� @a��.�wh ��oîh�a��wsa&��mor�_�vԁ�ou�q��� �����&vo�cǹ\����јy����x��&�x�j�$?�h�i������i�� �ܞ��� �cq��d4.c�?�a��ʊ��r<=i�������"�����#&ńmrݘ��[n|�^na t�4v�o��#�`�j�zm�<����qu��wh��j�4zj�s2j��>ah� b|χz�t�*v��w��&~�s�zuϟ�sh�fj��h��w��r k�?2h�dh���n� ap�٬�� u�\-�@�xa���ks�a|:��ko�����v)�2h� 5�d�zl�a�o½������48� `�yh)��>e�� >a�`�8i��;�-4cð!2� bx߁���h���'8�� ��ϻ�od|f�΂{h�e��� w������z�l�y2k˶��jn=���`z.ÿ:�xm�a��&��{5�c�1!)i)�ti��e\͡#� ��p�*>����fؠo�f�-���ȶ9ve���auuvq�| d7�j�;��l�آcu��oq·"�h�� j�|h�a���[/���~vjy�^�\u8�a%��{$lb��것[����xz�j7k��#��{���u�v�a�� v�3� ���shė,�d7k.���~6?5����k�*7\��ɋ��x�/iǁ����u���`]́*'������›��� �>������$��>���aŀ� i���i)�f�����'r�r}���8ˎ(;���,rg�x�f�bz��d6�a���y>�b�~7�� �nt��k n�.�g`��{�jc�p=��rz�b�4��j~�x�h��ΐ('a�ڐ�����߷�bz�b�mh0��?� !,�}n�v o>��r!����/0h #�.��di?��hb܁��f�9�&f���� ����q�oi���,ؠuj����tš����tsh�:mk���*%ů�����>=}��ph�av�c|�bz�ї:֗�[email protected]�*��՘� f���"��������7#0��a�s�^�d�(�a3��?(�����ĵ��v�r'��%�x���5s���cs�μ�1���s0h���w-f�i�];��w�c�õ; /�� �e��g����ep���rn������]��mb_ tvq��c��sq�"(ddxo����6{�h�8~��m��gj�g�ޓ����z�1��)��(���0��%��mo�d�ns�#!�[6{�l㞬0n�|��1�ޙr)]������0��r6� a�c?�4�� �w���3�oa���s*����m{��|v:������ ;a<�xƽ�&� 3 �q�����zx�����cet�l��ā}q2u,x�^�)��d�e��&��|�h[�4�j�!�255m�6ݘ�)[#�yk�q���}�ul�ȉw)� �,`�g�񑈷�l����;h����g&��zt�>t��&�����@f��3��`�y���2�o3�u~ q;ꎉhs����y�]��u��0h�l4��g�l�j��d��2 pu��f�~y���>�`zu��x �< �u�� a����)�m_�l�{��}�����8�� ��|r6��,y���x��ʴ� ��m��o�@tf�{sh7���y���s%\ꩃ;o10�v�ouiyqe��tz�������������x�g/h��6��f,p��*ܗ[�baa��q�s���t k�ϙw= ����ک�� ��bfz���@���c{�g�����c����p��� pb( p��� ���ş�����������q��q�'�o�q�4_6�� �55'-�ք�k�|�p��g��=�⸓qqq$/��8o ��5dq��� wz��s|�� w�n� ��d� yk��h9��n���*��?�yq�����w�-��xtp��u75he��k�9���~p`�j=��[����gkqws�s�'"�\z���d��kl<����k�����jć���i��nx� 2f�[email protected]�����l#$r�ee�� ���ioo�,$b�'�v�w�:���z` &��!��%�ǹo��doh�ld?���٦2�h*�lζ >z b��͒�h��s\�'/��d��du2��dĉ����#j�����u�pv�ڄ:��׃� lky�-x�f6q���y{���)k������;�ܹ��ө�hӑ�k����/�# �/����ą�&|��_c�=ĺtw��#g��[�q�)� ~b��� xw�x �ɮd�m�d�~�g{k$5�e�[kã��tnߌo�y0��#��'�c�c>ux�ȡ\�j��p�( �z��vq����ϟ�b����̋k�0�dni�_�` μ/ep��n*$���r&l�]�a �c�a���%��th��xfu n�<�m}՗�|��]ys��dd/���ǧ$�n�]�v�,e�ĝ������[n-�[�s�����x�~9�x%��%[�̤��a h(47uh���n�% � s�ÿ��� �w� l�[email protected]�_ �|�ih�ۉ� �k�ix�y��� ���}���z�w�����ʟbc $`it��8i9�ӏ%. @#o�1�'���ʙ�5����� �zb��qv�� �x�[z��l͘8'e\�ttd`bʪ����g�f*kp�:y���b��:xw'�gոx~} =�v�q���d �����$:�! )��)�]��e�m^]�����4- !�:ڭ�d�j�s�k����9�$%�o4t�0�(���qү��s����� ��}5�v����>n�-) ������ ?����o�}>"[email protected]�#��c� ����4f�b���2x�[email protected]�4z���_�v�'�.l�ztk"r��{"4|��.�fʈ�ï���:oyûlmrv�*bw� aڶ��"��ޭ=��ޮa}�vhs�vejšz�f�[4��&a���*�st�{�r[�u������[[�y/��������ʳ��ox nθ�7���"����:��l�%ĭ��w��|c{y����҆-�$zz�z���uk���ќ|m�c�z| ^f���j��j��7�󍈏�4����h(2me�h��h ��?�)���v�h�2^b��`�`|�v#���zi �d��e�b��b��ׂa ��4�j���3`k�z^�$����o��oknյk�{]�n��̖e� yyg��� ��<'�q��;��m\���(w�dk��s[j ��@q����� ���ߵ��e�"�����rd�e���|cp:g]�ۡ<�]�׭�/a�����]u�x x� ���f>������bx�%hq/s�mm�5�춚r�����s�`�� ��]��4�$���vyg8�dy{j���u���ճ���d���m����y'k��k�숪� i�#�a�z4����&���h2m�r�|k;������*hk������a�vį�g�`1�� �7 m�r���gwgv�� �*��g�o=�f�rgf{qa�66hpzz��q<�;�q�l��͐v%�} ��nh�^�դ� ;��ia�y��bŝy��m��\ρgem\y׭[0h��*c9�y�avh�,�!!��g_��>.�n~6οj\6� ݉��e��ym��i��.�����޵�b.�� `&�ze�j��kz����o � |�d�3�p����{�2��6�9p%�a�ޘ jݰ��qk�p���s��gy_��������b%spb#vl������z�ow�t�����$�̢��󲳳��7x5�w�j�{��z���nc>������ endstream endobj 92 0 obj << /type /font /subtype /type1 /tounicode 93 0 r /encoding 94 0 r /fontdescriptor 95 0 r /basefont /bmhikd mtsyb /lastchar 2 /widths [ 542 ] /firstchar 2 >> endobj 93 0 obj << /length 215 /filter /flatedecode >> stream h�tp1n�0 �� �):�֐.��<$ 괻"ю��hy�� 9n� <�g�h�k� ���޴�sdg?�a�b�j֙�v �a�i��cġ��cu ���c�6��{��-��6���'����5x��u8�af�?w��z�r5�ǡ ���*t�$�:�s\;s�,�j��h� �u��g31�l˽k�l��/ >d�\�w���hx endstream endobj 94 0 obj << /differences [ 2 /asteriskmath ] /type /encoding >> endobj 95 0 obj << /type /fontdescriptor /flags 262148 /stemv 50 /fontname /bmhikd mtsyb /fontbbox [ -16 -935 1043 896 ] /italicangle 0 /descent 0 /capheight 0 /fontfile3 96 0 r /ascent 0 /stemh 50 /charset (/asteriskmath) >> endobj 96 0 obj << /length 455 /subtype /type1c >> stream  bmhikd mtsyb��� {�;�������@ ?dasteriskmath1000炮捕鱼机 copyright (c) 1996 publish or perish and y&y, inc.mtsyb�����������������!�������y�����������6�h�{��{xz�x��z��u����������������i;j�����t�t����������~�lۏ�������u�t�t������������������|�g�1������������喭�������������n�u�����nuug���������ۗ�������]�spazp������i�c��������sҥt�����uoty���vyz�}��x��e���� ��e� � � �  endstream endobj 97 0 obj << /type /font /subtype /type1 /encoding /winansiencoding /fontdescriptor 98 0 r /basefont /bmhikb helveticaltstd-obl /lastchar 48 /widths [ 556 ] /firstchar 48 >> endobj 98 0 obj << /type /fontdescriptor /flags 96 /stemv 84 /fontname /bmhikb helveticaltstd-obl /fontbbox [ -170 -225 1116 931 ] /italicangle -12 /descent 0 /capheight 0 /fontfile3 99 0 r /ascent 0 /stemh 72 /charset (/zero) >> endobj 99 0 obj << /length 511 /subtype /type1c /filter /flatedecode >> stream h�l��kadz���cm��et�se����`ӄ)fzh�7a�;if��8;-.=x��v����$��`iao�xlo"��;98�`e��������f�xg<�(�����؝����"�-3?y����b%���~��秵�3�?w;y7��|�?��c�u%?��|�����c��b�4j:i䤇"��@*5#�[dp�=���9�kj.1)� �t �[email protected]���lh�m �(1mt5�cpk�ǎk��qi1dhk.a6`h��q0`b� �c��^z�t��̪������5��j �3{6�(v�/�1�h�-\x��"�п��j1g����$cqe�-���o(_{�����ʞ���ȱ��*@l�,lڋ]m�~t�����7��a��[s�(k-��u`���"�f$x����v����k\dx�ý��:������k����x.���ٹބ��w��b������f�u��� _m�k���aq{��<�9,i�΂v���� endstream endobj 100 0 obj << /type /font /subtype /type1 /encoding /winansiencoding /fontdescriptor 101 0 r /basefont /bmhpmj scalapro-bold /lastchar 114 /widths [ 667 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 461 0 0 0 282 0 0 267 0 581 505 0 0 377 ] /firstchar 67 >> endobj 101 0 obj << /type /fontdescriptor /flags 34 /stemv 117 /fontname /bmhpmj scalapro-bold /fontbbox [ -62 -256 1199 922 ] /italicangle 0 /descent 0 /capheight 0 /fontfile3 102 0 r /ascent 0 /stemh 42 /charset (/c/o/l/r/n/i/e) >> endobj 102 0 obj << /length 751 /subtype /type1c /filter /flatedecode >> stream h�t�mhsa���6��5�y�6��&���xp`����6�l)���s:�r����,�$�^0��,���y�$a*4���b}9�z���o�/���������bl�y��\�e� .��6�k.1�`� �t5^�k1��t��ߛ5p0jv e��(b�̶���y�xn��$�f~��/��8u�x�-������ vo�cr�է�b�s��v��ο��v)b��x ������*�x}����;q��d�\k=*��*��(3ujy( ��ҩfj�(գ�u ��a��ڰ�;�e6,�ņ�3؏� ~zo�^��h�5x?��zxe�e�׶t��c쀝��x��6��þr��]v�vd"�$��� r2i�ό]����[email protected]�($ �.h�=����g�wps��;wc�j��d�>����w$���ydi������ǿ�$�3$?v�m3����[email protected]�9>xi�3huй"[p�h����9i~yd��3(�n�h �b�`�cv����շ�g�� )�����n���� ��o���f� e���� �x�p��f:� ��2ц��o:��l��k9�ނ�m#8ax�n�u��2~#1f��������?�u����ܒ��s���ܫw�d��[�v/z2<� �͸�j.��[ϙ$�y[-��h og�� �{�}���7m����;��t'���]����f�r:::��r> endobj 104 0 obj << /type /fontdescriptor /flags 262176 /stemv 140 /fontname /bmhikc helveticaltstd-bold /fontbbox [ -170 -228 1003 962 ] /italicangle 0 /descent -220 /capheight 0 /fontfile3 105 0 r /ascent 0 /stemh 118 /charset (/s/h/e/n/g/q/i/u/q/one/h/a/l/two/y/f/three/m/l/v/four/f/five/j/z/comma/six/c/j/w/o/seven/b) >> endobj 105 0 obj << /length 2546 /subtype /type1c /filter /flatedecode >> stream h�lv tt���;�l���z3p�>!md�@�#����4ftt��ig 5e� \�x�j,l��̟y�?i�pr,����y��c��z玽z��]��=���w���w�� �� is�m�f_qb/���n��ul6��¦��r o�hx�0����<[��s{�s���rz�d>c�����[��x��42f��(}�� ���#[o��kp��9r�j���؞_�n-�u8 ��b�-v}b� ��huڋ��}�7�j^���;�m��l�rձxm� p{ ��d%�9-�cq�v��w�/���b�b�,za��]`sg�杹xq^�ݿ���q���ε;��ٯ��q��v9�ly��y����/�η� �s�c;x����������gy�x.��b �q�9n� �a<��q#8.��yn�m� ��乧8n6� d��s��w�;|.����,�հo�'�� ��0��"�b�p$�%���t�s�m�1�{c�1�xg����s�e���gct{`��nm&p�>�a�_t�m�v-j��3�c6'�?�>3i�e0�?с� ���>%/&�x�k����믝k��ͦ���v����� �x� j�<���kr�bqs�хŀ �0��8�p>q^������y�g�y��c����#^l2r��d����n]0v���{`2crw1<ǻp�br� �@&b� c [email protected]di�!���om�3ϟe��{��c��r#:!m�����`��q��j�(���������߱��r �4������ɕ��۔��"l�<��z� m� ��j�r��n&�o� �6c ���6�����k� ��*�_����-�|p#d�ӵk�v��d�f�~���c�;-�{����=����o�u��� l�@ ؏cb$b� 1���xvz�a��m������v�&y�%o������m����т����!���ؽtp��v����w/5�p�r�ugn��o�c���-<�����o�� z�?��1�w��x�c�g2��d,y���� �o��/vmun� �? �{s�k��~<��-���`��r�@� �{�⸽v�&�=��daia����}!���zm* �)��q���:i�t������i�����t� /a4��!�3[z �d�ѽ9�֍�1z��k���]�.����ݛ�ȯu������^��2���u�b�z�vw�� ���za�kl �a (�=�*�x��}y7�'r��� ���y �j{* �zl�l{� �tbz� ��v|��yg7�*4e���$#i��"���@�₴�s]���?��䱝���o\� 3��ʷbb�2o� �̹��y�rq��,��y������rp�u�0���p(ԟ�����!{�xdȯ^p{�|�b�p;~y�Š�ŗ�s -�]�� `x �bk�g��9�&�<~̳�p��r��%�jg �uӎ����a��:�(�=� cكj]j'��� ���0��j�u�k��7j���5�x-�� ks���k/�?f#�8���4�r0uڡg vɰ��p��x��ys �ky�hq��dm,ō�h?i�l����kͽ��em�lj�'��wf6����f��� br� 4\��;y�1q��fu�,;�yf~� �6[1�-$��:;���p홫�ێ�ߧh�����5n# m ͼ��~v��dznf�����h݉��o��۷m��a�ac� �]�����8� �r�sh|��� ��|�͗{�$*��ef]i �x�(�b�|��.0�a�y��g��[e-%&/ӓ���n�! ��^7a�l.�e����f�& � l�g��wfoc�!��v�pa�d����,m�v����4�|ҝ�,���1࢓�w�����c�ah�:wy�ehf6x�ܥm����ap�'�c[ ���4�6�cj�����`��xl���%@�o~k���t�&�\�$%����� � /�q>x���}e�zh�(uk2n�����5u䄢�e�ir\����>���ϳ<-�u�5��'���񙶅�jp�;|��x�{_vl�)xyg��3�f�'l�:�'d��1��ff�i���20�~3;�cu�f��y'������w�y= �]n���?d2�����;�a����j)��>f�|��������; �꥿�q3q�#�%ǚ8���.� ��`t��0�sݺx�[�\�kæ0q��%0���`� t���aꡏ�z;��g�qsx�gq�a�����'����.ݽ.vbka�,���'�o����ϙ;u�����m��m���s�i]`i�?���ؘ�� =������"�_�����3�� "�s�,��(*>�qg��bڢ�!�a�p]�h��q��f]�m9;1{;���s a5��v���z��7��mzi]�a�g�/}�@p���5ѷ��j�[��?�k endstream endobj 106 0 obj << /type /font /subtype /type1 /encoding /winansiencoding /fontdescriptor 107 0 r /basefont /bmhijo universltstd-obl /lastchar 121 /widths [ 278 0 556 556 556 556 556 556 556 556 556 556 0 0 0 0 0 0 0 722 0 0 722 611 556 778 722 278 556 0 556 944 778 0 0 0 667 667 0 0 667 1000 722 667 611 0 0 0 0 0 0 556 0 500 611 556 333 611 611 278 0 0 278 944 611 611 611 0 389 500 333 611 0 0 0 556 ] /firstchar 46 >> endobj 107 0 obj << /type /fontdescriptor /flags 96 /stemv 100 /fontname /bmhijo universltstd-obl /fontbbox [ -174 -272 1145 947 ] /italicangle -12 /descent -204 /capheight 0 /fontfile3 108 0 r /ascent 733 /stemh 86 /charset (/e/l/e/c/t/r/o/p/h/s/i/zero/f/n/s/period/i/g/one/nine/two/a/m/j/h/u/six/four/five/three/eight/w/d/m/v/a/d/f/n/y/r/y/x/z/l/g/seven) >> endobj 108 0 obj << /length 4140 /subtype /type1c /filter /flatedecode >> stream h�twyxƕ�a�u��p�v{ը�a�wԙ[email protected]�*��, � �2,*�ņm#(�� �5n��@p�"�e6==��˭��������s�u}ίn��l%���b������u����e�;'�p/3�)< �uc�u���f��׍�ӆ����ckǐm5�hq���va�h���7t:w��bs2.�;<��-l�����i�yyȥ��!�����@� �"h�*�#]��/ �*e!2e�v�o�s��e �{��=dj�r�\�5�=��w( �.�����o����4t��% pwn�yk��a�� �r� >rb�r�%�jc}eҵs�h�'��j���n�qv���{ʆ�#�����)s���g�qj�”�/�g�<(0���d�e�i�r*'�������>�x��������#���h`�#�/,�x ˑ�^w�(l��� ln�k�n���ag��j�/�t�-][�x�j��o�qo���-��|Ԫ���֧���t �vd�����fmuq����v�� �v�lq�fۏ��j���\�4#>i��& �~|c���t :�� �n4iz�y���d��������d�6�q��p�sx���[��g·=p�g4�kxl��awzu���oؒ[i�np�7/�) ����{�xa��?�zr$0��"�v0���>��b��� �a�/�87\m��jdp¨�t�-5��y�[�ç��=��t�'7�u�b~o��o��6q��t�;q ���&]]��2�i�q2�f��ﱆ[�>je��d)y] b{w}%o��#��;y�o�t��a��x��2��8j�w�<3�!��c�f��� ��p�f;�r����>��r�3��� ԉ�z~�n3�ݹ��x6�g�oݹ~��>�2[w�i4�u��6�q���|o���� ��m���k�g���;� k��j��t�[|�:#�0��gg��i�����i�k� �( �#�,�z^�t#���-���$d�ފ��b�g��a���0b������� ��xݖ�`�6�rpm��1a�5�t;j?r0� ���/ϫ`�u8����q�av�sq�an���=�uo �ucq��a�g�:|�$�0�:��.��ra���8���ȅ�qʆv)��x��(0n�e���%o0�n��5�c��;/���a��9��|���u�l:z������c� �b�ٳ� �c���d`���4���~0�9�qe�&8��6��| [�e=d�\^(����<����\�\c�^_,�] ��d��w ���`ܔb١�웿g�����<�&<�ū�1c��cz�[���me3]���m ݾa�6�}���e>�~̶��`�ckp'~&yt��� ��܆�����nk���\���'�n�m�p����-}���!6�" �\1���b�u8�.�;ֹ�br �ة��x,��wx������x:lm]n�e�v�h/l�m٥!u�sp ��h���l�7n� �-��6��`m͆������co��0c��<�0@0��� ���!d�s{sr�t͐��)\���[��v�z emf�>�j����w���0��m�����t�(y�e��b���j�s9w����?z�3�x����!셰�5��(���c�$r� �ců�y���~ai6 m�4�t��d]f�p=4spgx��'��ayk$�� �z�d�l>��u���e�u~g��� �ְ>�i.�9l���z�u���i׬���20aa���̳\#��f�,b�؏j q�^�z�8z��y��8|;����_���kٷծ�i�hnz wu�6��v��%�lț�cu�da7��mdf���h�k�nt�j�3ɒ�dr ���>wop ��@t�%��qk�]�'[�ok�l�l�8����$��]a�!�&� �(�y�����奖����jm�v�ef� �y��ʃ �h ���l wol0|���q�6�a0a=�}hյ�q�x��d��'��"ĝ�m�7k�7^ao��s�y5�su�u�s�q;b|����i�|�i� �ɔ�n�wr�cbg-a/@�ܐo�h!��ҩ�y� r&�q���秺�q��;�/2^���ʦ���բ��k~--:{��o7�_�tf��~����c��b �c��%���#x[�&9���ȯq/���[email protected]����>�����і���{0�� ����5�>e���j�y�0��x�=�!��l��調۹�(�8��5}�mv� ��c���t.�%e�e�r�����.��ŵo��<�e:��̎���9yp��� a�ڀq� ��l�ܧz�i��{�b�c��<fo � ϰ�o�����-�w����!�x^d����z���wsx —4�|;��s����`3��k4b � wa&qmrx ���ka��p %��д���luf��&�����u���d���~ь���οi��w�ʍ� m�k�e| _��ki����? i�49��w8$߇i� �����f*�>��������l�uhl�;p"���r�e�%�ny��&�g�lw�c)9���Š�a.3l�b�=�/p���sir�j�b��xo�"��*�c��uu�w9&bgpr�>%͜��$iԋġ 9�����.l�z�ƽ;s�o�ld��=��rb��w޸n�g?z �oc�6�t���ʗ�����${,s�¦d����ll,cal{���m��tx�n��{�8w:��tm#�=vq(iҹ��� ��ye��7 � |>o-�m ��,� -����`��c��rf�y��v���{(s��nt� �̾c0^-16c�s��� �/�3x��g�uw�vk`"{�t�e��鞤co���`�cag���w`��%�<��06�!i�ę;��ϡ�|���0��y�_�u�z�2=�6cv��[w��?}��~ q~˩�,�1�]b9�fb*�u-�>kl3o�t��ꭒ��� v��эa\xp�r�u��h� ջ��xs� om��uk��hu��~���9�g��v���ᯇ�*�����p�g��t�%���n�l]��g7���y ��!<4>�n�#�=ښ*خ�hj�h<���m�m�-u�ח܋;�w�k���(f�����vu-�c�a��`������"�(���(�1.'8�g�]��jl���x����w @��o|o�z�9�%�/29�]}���j��8�_��1/������܎��yǯ�x��݁s�)����w�!o~hb�����2�%�d�=��'q�l%| ɢ�f��� ӯc8�x}�ᑡ���9���6�n-=xy��ivfu�=�q� i{��$�߂����s�i�ъ���o��?q�;dĺ��'�]�^s��tl�b��ʠp�t\�u��l�n�j��ydl�ak}b��#c~_s��u����.բ�%��9\v��d?�`�mp;)ru�&g7�9��&x��5c1?��z~b����d�[br�5��y����b�^� ��yؕ���i�j���j`n���[l[�j> endobj 110 0 obj << /length 318 /filter /flatedecode >> stream h�\q=o� ��7���c'��g�2�cmڥ���9�tc��!���i��x�{�x���l7v���mg��q8;�p�sg iawj�oaw}c��x'�w�@j�_�r����^�r]gn�8$�od���~a�fu[���>6=��_�p�i8's�a�h��1')� d[t�f��c˨8��ql�*��7��p*��p)". {#��#�y���d[���� ���p��&5ko�a��"!�� ���?{%�c���k~�w/.h��љ���$����t�v�����(c�>���u�v�>f�ط���� endstream endobj 111 0 obj << /differences [ 2 /f_l /f_i 40 /parenleft /parenright 44 /comma /hyphen /period /slash /zero /one /two /three /four /five /six /seven /eight /nine /colon 64 /at /a /b /c /d /e /f /g /h /i /j /k /l /m /n /o /p /q /r /s /t /u /v /w /x /y /z /bracketleft 93 /bracketright 97 /a /b /c /d /e /f /g /h /i /j /k /l /m /n /o /p 114 /r /s /t /u /v /w /x /y /z 133 /endash 144 /quoteright 246 /odieresis ] /type /encoding >> endobj 112 0 obj << /type /fontdescriptor /flags 4 /stemv 100 /fontname /bmhika universltstd /xheight 510 /fontbbox [ -168 -250 992 947 ] /italicangle 0 /descent -204 /capheight 734 /fontfile3 113 0 r /ascent 733 /stemh 86 /charset (/comma/one/d/e/p/a/r/t/m/n/o/f/f/s/i/c/g/w/c/h/s/l/b/m/d/u/u/v/y/g/p/period/r/two/i/t/y/b/h/three/j/l/four/five/z/six/seven/k/a/j/zero/nine/slash/parenleft/parenright/v/o/colon/w/at/n/x/f_l/q/endash/f_i/hyphen/k/e/eight/bracketleft/bracketright/quoteright/odieresis/z/x) >> endobj 113 0 obj << /length 5387 /subtype /type1c /filter /flatedecode >> stream hޜx t��f�gu�&q:v� .hd��!&� �""°(�� .��� ���� � ��w\pq �l�(z=�!��n��s�������{��u�u}5 �v��������c� ��h�g&�i��������ab����㭣�k�[m��l�yd�ԡg��� ? ����ng�4�sx��n�;�9�� e?�.�c���le�3v��ũ˶.�� 7� �r�u,5x�i�)�$��g�& jhtc �s��d�o��qh�i����vﮪޝ��a��å*���n]�л�<;i�>d�b�k�i��!� ��3�p?��&ǣ�犸����=q�=�9415���m o�:� �sxs������ ���w��>���w����8t��g��|s�y�ni�h�d� �������o�i9�(?�p�qumz����go��� � ei ��尶����z������-h,1}k�5ܔ1 �p��zqb�$2e�sxs����<��b����06h/�#�v^y�%���`=$(8�.������k����2�`��ސ�1 k����� �ɹ��#�fo:p7yp,/��`�cɹ���^*��9�~��0��|_ԝ�9��d0tk�s�#os` �j��t��[��� 8�� ��r���͵k�w��gi��ia rq(�~7�]�����8�9�a䢂��@)��=u$θ��q���s� ��koz� m���l��<#}&ve j�jmi��)�8��cat-tb�3����4`�y��5��]<�.��öu;�2��dm ��z�h1�ҵ��u}�a�v!91y�*ռ㺓u i�o�����8�|8lg-|�v�嫂u��5����8��^� ��a s�?ts&r���x� m;��97=g ;�r$ p�_ ���ҝ*)/��o�y�4��)�� d�q:�h��{�1l���~��gb�ic ������,��' �ъ9�jx���*������xg �4�r���p���y��� �޹~[yf����a�v]�-�� ���<��-t� ����2���ז0���*�5���o����j o��o$?i�vb6 � ����flasfs�҉1>�z�(`;:)���%�š~ �:���apw��i�e��xᙤ�it~�vق/���{��›�0xըm�������?��ɑ��ʪ9g�r�t���kb�/�� �?�q�h��p��!����izn �ua $«�� ��� �mnh�msꚥu��p מ�52\���j ��?��� �br�e�$5�����i n��}�>� �����ݾ\��ƪz���7��}��r��m�v�w:�.�%�f�;qc]w\�'̺����������]�yʽ���eh����p=��ꛤu���6a�ce�1��c=\�\��h�f�e� ύ�b%y!�i�s���i�}�����#���>t�;s�,���n�����k��|��>g���қfi�m������p���w�'�c9��h��w(��w�0�2v�{�8�����1`������ ����׶ f k[ut ��<�ʿ5���9��\ ���;bot�#ab⿮z�{�̫����p�(�&#]��_��s� a��p rq/ė�%���3?j�źop,�!�̄�la���7�م�� ��j��b߳$'��섎s�gz�x��oj�n��� ^�v�v�r��g<��j�g�4[@{l�����y���b\q�q�d�� j��&g��|�)��n���d��{t��)�|�73����u�,z|��uqtl�=�`� l�����x��(�ze̴��k�� �xfi���s�s�i�o���q0�oh�����]� x�f�b� �}.y�%-җ��$���a���*�����-�dg����'/y�v���fh�p� ���%�>���8��)so��]/�嚋[email protected]��uw� �k�хp>4�o� �������:l�?�ɹ�e����s�o��� &��w��_���ڢu�.r�n{3�y�t�g��k��y����_h �q �;ú�'�����2b�w�/h�6�_4hk�l2���g1?�6�,-��c�-�� w�tw�s��&�fp ���n����򬸼g*q���ٖaf�(�;0�f�(�c3g1�ԋ~b e�d�rў� �{lj�f����pf�&2���4 ��vnj��-"i��lcgs=�)�d����ք9)�q��8jzdֱ�iaa"�:,��q(�m )�@�l<��� �/hc�;)ؾ�<���z���0>��|�ʜ3�su�����ۊ'�l.��$�q��=c��2�צ�m�s�1�d�\!m��,�)h̨-�1���� �u��ot�uךao �ƀ�&t��,��uo���r1�6���&u$r{�����ȑ{]�y߮���!i�ik��� 7��'�jw ;� ������)q��𤰙˜ &���"�k@vp���i��-i�j��lq$����#bb������ܰ؋y���pl`t{��w ub�_e� �uv�‘f�&[���6�db�����[�,�~�tr6w��o�o9���4��]h��'����v/�@�j���)�$9� �p(�#�|����x���'~~gy����1���5ח����}\�qv��5=sg� sk'��t���f����9y8g��������t']*9��[�/�����xei�e�dwэ�zt-8�b�#n�h�|�p��'f���[�6mo�y-��/����(c�֛��þ(ӽu�á/9�]��g�ge��wu)����[����| �$�y=�d��no���''�x #f�:�u�ї�`ȼₜ=���i'����c��]<���чt!�aw���ʁ|�����?�0e�r���y 9��bv}lxz$7�_�8f�[��m5��f�[���k�}�,�p�|�n�>�$�}�Ÿ���� �w�4<`ǥm>ܝ�o ���ҋ����l�۩��`�iлq�b��p���g�ow?5g�]pk�.�.�� �h��φd\�� x��b͏nd����ԉ��!g�� ����k�0����9s�r���zrn�`}�p6���-��], �� x\�ee�٫w󿆏�5���3lv�g��*��>��� �z�25̻ ���=r�f����~���e�{>1ɖ����| t�z���oe� �������f����o�@���� �hʗ _�r�zs���rr������5�m�fsб�h(�`���oa?jt�71��j^�j_��5͔�(�t�2v�9���t�f�}��k9�����7�g�=|q�e{ ��wn;�� �s^�.sؼr�r_>���2��z�e���q��e��q�-�8�[`���e���_v.[���c=�ڶ �w׋j�%������e*�_�2��v�g:軘�9����)s����b�;�n�r��$�hwij�3�~ �k�c����֪�� ��cw�����8�yηjߺ���s��;���]�8���|�3�h�}�_%m� h��d���z,t\5b�}��q�t�wʪh��у=m��������nl�\�w�׺(�a��k����#{�<�͎u��1�j�}w�/����}:��ߨߐ,#�o�i��a���}?y��������r�ct�� ݑ���$=�x젯�k�η��/��=��%u����}|؁�m(�/i����~�a��[ߏn���,c���հ�;=8���e����(�a\�������v�䵱���ؒc)f�'>-�h�j�[�q� ���nj_޿~��l��vy�r��p�#��������q=���ue���|\���cq��ky� ߒ������� �~m����/e�d��x��n�! &����� h�[email protected]��tm�0���%\5r�s=�~��~%��z�`���cd�w��o5�g�l%���io.䤬&:����\��;"��\֕&5ң� )��v{q�6di���r�� �@��a��� ��'�\�ޘif�|�'�pљv�ȶ���^��a���4~e�p kt�acj�3��>l���p�ߓ���\[ѻ siȅf� �~ �2���ȭp��/1�ir����!�ܬ<���7 5��@������؎}��% s{�5̓�6�������ڲ;�2��0�z�yh2������\�0zq����r)o�w�_��]ü&z��`���0��{�!e� �^�> endobj 115 0 obj << /length 302 /filter /flatedecode >> stream h�\q�n� �� ���0nly�|h�j9�:���ڵtc��c�� $�� � �l���ͱ{v�jp�n0��<�bh� ����.�j���ӽ�7�u��:�w��}q�o�=9�n0=������/�,���ac��탴�rd`���na�}z�4�v*t��5t����{���h;�)]r�srrn �2�n�wv�}�wb�h`p��2n8�� l�d��y� �dkx����-x r�\\�k����k~z��fy�6�/�>\����qac�b�|���~���b��| 0�) endstream endobj 116 0 obj << /differences [ 2 /f_i 45 /hyphen /period 48 /zero /one /two /three /four /five /six /seven /eight /nine /colon 65 /a 67 /c /d /e /f 73 /i 75 /k /l /m /n /o /p /q /r /s /t /u 97 /a /b /c /d /e /f /g /h /i /j /k /l /m /n /o /p 114 /r /s /t /u /v /w /x /y /z ] /type /encoding >> endobj 117 0 obj << /type /fontdescriptor /flags 262148 /stemv 155 /fontname /bmhpmf universltstd-bold /xheight 513 /fontbbox [ -167 -250 995 938 ] /italicangle 0 /descent -202 /capheight 735 /fontfile3 118 0 r /ascent 734 /stemh 120 /charset (/d/e/v/l/o/p/m/n/t/a/i/d/f/h/m/c/r/t/two/zero/a/i/s/y/k/w/colon/one/u/c/e/hyphen/b/o/s/l/r/f/u/period/j/g/n/f_i/three/q/four/p/five/six/seven/z/eight/x/nine/k) >> endobj 118 0 obj << /length 4456 /subtype /type1c /filter /flatedecode >> stream h�twy\��n 3 h�2�����^������z��=,qdq� ����"[email protected]aaq�b hŵ.��va�}�{��wb�������#����9��<���z��b�i~>s����v'�4� �b�&�d��&9a�x�o& ��f���zb|!�ߥ��! �����ĺ� փcbs4���ۘў��;ƭ��e�wd�w������]��r���'���3��c4�1��u���;2r�#(^�qū4i���iw��,�:d�҄�4�)�������pu�*z�=�����}��xe�2a�� �d(cb���蘄�xv���;����u�r�lw)����s�q����!���<'4t��� lq� �}w�j���c��ru�f�np�d��%<:0j�_�pv�h�j|�h,>:^�����qa>���;��x��b4d$�����d��i}d�2q�h4���"�(etw�/q���^��j�/%��l̦�e�uӈ8bqi<%9��%_h=���/e�e-�v�g-xl�x�ۿw��˯-y�>�~6���^�gɋ�7�x�i�s�ow_ͼ���}[�y�h�q�l�m��7����h0�fy�6:h�dm4�:�|��\��/���p�6���'7���4�hnc [email protected]�rn��a��6p���@�d��t�[email protected]&>�0�k��k;�&�t�5x���úؚ�ym jhf��9�5������轛���&�/�������/9� \�7f�b�/�{�v ;`�买��{����r���融h�@��129b$bx�eu�`8r���4�� ���2[fս׭� ˖�e�<�ѯ��#����$� z�/�q��7'�������c��bw�edd�h��`k��ȫ� v�n��q�ja>�u1vw ����`(���疞�"��.h̗qϗ��s���@�i��i����uy �"ex{�õu'c��fo�f������� p���|�t�as` � ӵv��h��(������#��b�r��9h�a2�htit!#�z��֥�lt _4e��#��i�� �iu��(���w���pn�;�8ê����go'�b`���ޠtz�̼vg&'r�m�i ���t�a=���į��ژ���|\��lm�� ������ƞv⨪�;��k(���݅!l줬�9ǩ)h(r*f�( 6߿pz[�65�to��7�o y��a�������l^b�<��ˏ=����'vy9.�ze��p�d�%���p�dی� g�&������ �0zyă�vvt'�& �踍ԫeq�i! d���� �}�we��bc��3f��꼹���'��?�9�5��@�ψ����o��'�nv5�����j���ޡf�v޼|�ts���w�c9yh��b��`o�i%x�hl�k��?�y0� �hrv�g֣o��0�h����a�@"&0��l�1��gnzr�t�ۛ- f/m����d�ҁ� �]k��"!� �ܒ���r�!�cx�u^�/uj��ht�)�{��pc�g�ϕd��aձv���5j!��)au��ܑxro��b* �h�����?rd)h�c� z��h}x��=�|%��p c��,��� �c`-8��.�rԛ���'���\hž�npfj�yc"y�ܐ� �����f�.h�6���h�̠�ܐ9�s��-e��g��*�3�h�lvŋ�[f0)q99k8�����l �s.� �dx�,p �x�dҕ�-x�4|�x� k�-p�����af 5&0�v|���wt�� )_�u�r�u�p�mx\0#a�ь��l`�#� ma�u�g.r�q}�z�� ¡�n��$各��a%c�bp6)�-"!����$,��d���tr4ƹ9 � ���_�� h:��w; ��`k}�n �h*r�b���5�ikr���rt&�(om��>�)�𐜂�����govz����0/��w��̺7�������{�t8-b 8�ȣ����>\_���n q/�w�� �t�ʈ�^���l=t�ȭ��~�b�ħ��y�=q���(p��.��-�������͟՛ϫ���9#�mob�6����3���÷h�a  1t�h�7��j�փ��3�d��,���s f `�bsp�-��%,u�dgq.��}�`h`�d}c�as�nw�qu�� _ԃ5 ��th��t���� $��)����-k���wy$v�;d`cb��������|p�=�����2c��m[�n>��?i�2�"�v��� �fq&�ie ;�q,?n'c�ے�{��0��� �x��t�8z���j5a| ����\��a�)�1����au�tzj�m�r�q��`ԧ � �{6�ls\>s��q��f�1�,㛃γ��wod�r�!�7��l1l\���x�>k1{a�'�[email protected]���39ox �bhw �x� �f���1���u8�����t��y��[e�h}��g�h|�hmgp�n�������2b�&�~�u �_�� �r���i���19��)�>rl�jl�s��z㩬�z�v�uw�'��%_�2��f�^�q'��t�2jr;�];v�%������-���֔��պ��|�gu9�z��. *�b��v&�b��/qt�z>!/����a#����kl�e�&���w��?�`�� �#��@����q?fp �z6$�`8�s��k6��a�a� �j�y�5����ɞ���rd/�1���5�g�e�v����[email protected] g�i��� �dg���f��\0q�# �thrމ�a_e�5c���^�-������:���u��ܐע���a����r����u��:�c���>��ro��:1e���ũ'�b�8��c�:p ��0�ޓ�:�ʠ/\m� ���30�5��j�z{d����{r'}�����rew� �p�1�>�z�j� ��d/j d#s��v1�1w~��ɯ��� f�!0���"h�)�m� ٳ�mf,k� �<�j�(ɩl�_�.hz�q��n�[s͝�ͫ՗�c�� ]���o ����� ט'z�̗4�u�.�׵ekuww��n�}��t�<ȟ��3w�]�r��� /0��� ۨ��ܴ�c�h�j��70�9����~] 6�c�a��->d�zu� ��naṙ��� �kʿz��y�)�5�ti ��.gsh�� `��v�\��ln��a�9cu� �z�>�ld���~�1|~"��6,�iσ�� ��{3�=f&u9�:�j��tv�1?6�e��h[�֧`��/��ȸ�.�_�a �����`�~ǧ;r{s]~�1rј���?��`/�����t\wv��~�� ��l���,��oc����9'4 {�n)����0�^���h�6$�:-�׊��1m��!\�!&��v8 �k�q�6(���:jw�󂽉�1s������3��6]v�q�7�ur��*�aǣ��!,j����;��?��6'�e��\j=�o�=��mj�,��66��j�6���d̰���t�j�r�@6�!b����כ(�&ㄮk3�j �{5 ٲ]�� ����wp�r��$j�pp�,�`��hz�{� ����i�]ǀ!�_��e���'�p�;�rq&�m�la�#�3b�x�f�e~��yp���9�d/ �}�be��i� 0� �$�� ��o0a�õ'����?���<���e�b�ŏ>��np�}��g^f;��_�h�����׏�}zl;oک|�b�y�m��ݧ��>��mn=�]�=���rd�u���u2�fv'�8��;)^�ak�o��g� ��k��0 �s� ���e�w�]c���ӧ7v�q9�� v���w)�����_���c���<���s�9�o5'�s�i��ԝ) �(m�b?mue��t����k�kb��tv�]"3�?\�� ,_bzr�"��~�c'*��n�pvk(<�����cp5�n8l�:��p�t�o� bc]��μ8�\z�q�y>ؒ�e�]��pw� b��z`����oqϸ�f���z�k���!i>~f=�i�)�m�d�"�!� &�7��=ź���3-cz�ir7>��"�۴վ�7�,�#p��4�s�-s��%a�v\ thv��{�4�*#��|~o�_o�};a4��lڣ1�0��� i�~zq>f�i�bc�,4���҂k2a�i#"�;$�wxy4��}%�&k*���oq p���cb� �a�'ql��|x �� w���'��l���]�$�]�e)�;���t��ߥ������m0> endobj 120 0 obj << /length 239 /filter /flatedecode >> stream h�tp�n� ���-/j�c��aw�h.�p|i�a� ŀ0.��κ(h�1��k�ݥ�.}o��at�&\š €���xg����:-�~[2νhi�g).9mpx��=}k�����$�5���g`�x =����g�x��d��>:x\�6���$ �=*@o���ӎ1��['r���b(�1q*x� �x�u��k�)z;�*ׅ�.͚ry�]�٬����b��o}�w��p� endstream endobj 121 0 obj << /differences [ 2 /asteriskmath 43 /plus 177 /plusminus 215 /multiply ] /type /encoding >> endobj 122 0 obj << /type /fontdescriptor /flags 4 /stemv 50 /fontname /bmhpmi mtsy /fontbbox [ 0 -954 1043 796 ] /italicangle 0 /descent 0 /capheight 0 /fontfile3 123 0 r /ascent 0 /stemh 50 /charset (/asteriskmath/multiply/plusminus/plus) >> endobj 123 0 obj << /length 577 /subtype /type1c /filter /flatedecode >> stream h�$��oa���,��e-�py5ѵimh��&z?��j0��d�n���c �t[v)m�.��ڃ�d=�g�$�w��&�����$3�\&��e�e!��˞k�<�=�m��c͎���(sh���_���4x����p��;�s'նp�0��9~<��q tg�����`w��q���@��]�䰏� e�@<�ǰ;�gu? �@x �o�{�h�a�tuc���s���3}�r(�����r1������glc�ayj�2��76)��e�z�(:�|��Ԭ u� �!�����:���f�~��� �vss���hfg�� �����[email protected]��b$^]�my�@&�@3�w�i[� ?`n|w:a�q�j�6k���b��bq�*�iy�-��rҗj�f�b=^�s�2�<�� v��'�m:�n-�l�df:�ȧ�d�:uh�e\����8�l�*�evj.f ���bnv �'n:��x�:�(l .�����y[�� ˎe��$y���%�h^�� �vi. ��i}�n�5�n�x �j���ƭ��g�h�j;[�zx.�ev�{խ��l)l�?�s � endstream endobj 124 0 obj << /type /font /subtype /type1 /encoding 125 0 r /fontdescriptor 126 0 r /basefont /bmhpmh wingdings /lastchar 2 /widths [ 939 ] /firstchar 2 >> endobj 125 0 obj << /differences [ 2 /pc ] /type /encoding >> endobj 126 0 obj << /type /fontdescriptor /flags 4 /stemv 24 /fontname /bmhpmh wingdings /fontbbox [ 0 -211 1359 899 ] /italicangle 0 /descent 0 /capheight 0 /fontfile3 127 0 r /ascent 0 /stemh 24 /charset (/pc) >> endobj 127 0 obj << /length 502 /subtype /type1c /filter /flatedecode >> stream h�bd`ab`ddt�������ko�b�����,?dyĺ�˰��g���=^�{���3��� � ��� *�2�3jv*zz)�f&�秕(8��)$��)���)8��(�� ������ t���bhea�bp~niif~^���g^2v]�200�30z10=��¨����}��/�a��������k;y���@�������.�w�o�o9�b��rlάum��r�?�f_ݼ�j�\��m�����a���۟&ѕ^���&ggiu����>gң��v�e=�c^tq�� �&n�ٻh���♝��'��ֆj�.g/�km�kk��(����vr�7�u�mb�̅re�cd���_t��آ�@|��/ xrl���� ���'�e a?)"o��?6�{d���'7�5oyоf��ۚ����o��?���2�5���mn.�ϋ����y���,���^�%�'�89�a��s1�b�ŋyx�� �s[�# endstream endobj 128 0 obj << /type /font /subtype /type1 /encoding /winansiencoding /fontdescriptor 129 0 r /basefont /bmhijp helveticaltstd-roman /lastchar 169 /widths [ 667 0 0 0 0 0 278 333 278 0 556 556 556 556 556 556 556 556 556 556 0 0 0 0 0 0 0 667 0 722 0 667 0 778 722 278 0 667 556 0 0 0 0 0 0 0 0 0 667 944 0 667 0 0 0 0 0 0 0 556 556 0 0 556 0 556 556 222 0 0 222 833 556 556 0 0 333 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 556 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 737 ] /firstchar 38 >> endobj 129 0 obj << /type /fontdescriptor /flags 32 /stemv 88 /fontname /bmhijp helveticaltstd-roman /fontbbox [ -166 -225 1000 931 ] /italicangle 0 /descent -223 /capheight 0 /fontfile3 130 0 r /ascent 0 /stemh 76 /charset (/two/zero/one/nine/endash/1000炮捕鱼机 copyright/w/i/l/e/y/hyphen/v/c/h/e/r/l/a/g/g/m/b/ampersand/o/period/k/a/comma/i/n/h/three/four/five/six/seven/eight) >> endobj 130 0 obj << /length 2895 /subtype /type1c /filter /flatedecode >> stream h�lvx��a��ӛ;��,����!�q! �b�vau4x�$���4b0��'1m3����d��4e� �,�\��o�xv߻k��{����w��s����{�9�2� ˲>c�fo���j~5�lmo5nol�� ђa�t��dfi_o���cq�â�c8؋��]�ӳv�x�qbٸi������ ���!�a��rl� qː�.٥ �t�\@�s��4��lh�ϱ�3r љ���,k��jna�x�uch�!ۜc��u �djh�1 �lc�9ø��`�g���i��g� �(�j4?��f�� ���aƈ��x��i53� �z??o^z��k�a�7pn�o�jζ�h�0ن�k��s��s��̜��g3��’mh��j�3s�濖�2lsg�m��� �w7�)��0~ �3�eưl(�ld�) 3ճ��0 ca�} 3������lxvf�w�38����֠�yrť������o5���j ���wh3j�)ì��r'���۬�c�sj�� x�i*ݼ�t>��j�:=q�*�þ��y�-5���#�� �j�@b[�ѩ�bal?���������c�(r�|��w�bo��gs���yq�֭ p��n#s���r�m�3q�f׋\��p� #�*�̥�a}3 ��$��j2�%�q���g�����,?���z>�/�ʼnc�>����ő۠��2d}�.�`��3��_ɵft��c3d6��pܩ!e�t���p� �q�˘�#��t8zw�)�v�uxϡ �h��� z��o���f��(��\�^�ŷ?9�}�� q���v`˃b�͈3(����o�� 򚦂2'}y�q$��wrp�w;��x��_�jr�&���af��@�d'�sni��d%�.]���86{n��l�i�"ދ�hi ҧ�_xq�{��/d�,p5y��t��}[��wgoq&j?�5c����z���;rw��x�&��:��κ�{ǿ��n#t���t3{� ��i` �.��r�[-.�pڒ�b��i�ʟ֨�|t%��xs ��/�hŧ��[� �q୔6k�c���v{��c��p}.7y�h��p�aq�nsg��,����k;m�z�󑉻�7��f�'v 8��x���zj'-v��s4y[����a�xͨ����(_s y�`�au8�a �͘.����� �������c��a��쬽]c\v�5v�v��"���g&��׮_z�\��ev������h���ʏ_3�e�8��el� π�w����b�om�!(��p/� _|'��`/��ί8���� ���`��4�?��y4d;�c��i�� �\=��3�l�� =���iz�]�v�v��xg��;m�{�wgح�qe�# �g:o� p _r������ۆv{g�����c��f��1ڍ� ��,�r!�fb8dx�b������z_z�r� �e�w��a�k���ܐ�yz�npwyx�n6�b)�]-� "-�/�����)���w�t� ���h�<�&��&��!��.��n\��'c/�>w�{� h��ͧn�wf$��~3�p�����v�������äi :�x�!�{b�o��|\���pyxj�e�zȋu ���pk������$�m�۾j���@[��s��� 6rg��� ���uj>�-�6�)f_�a_ ðp�eyqz��l���=y�b�o����ciķ�}��kr��he�v�u����ӫ��sū׬[)g'�����mus���"[dj4��j�������[z��y�v��iv���l�i�t���@:� ���8 3�t�4o�^d����2myq8�j=�cʠ�i ���v%�m�.]���om���oܤ���.����>�c�?�m >7�����흦�p <����� keǥ��������у����"�[��_� endstream endobj 131 0 obj << /type /annot /subtype /link /c [ 0 1 1 ] /rect [ 107.01 594.219 118.443 605.652 ] /border [ 0 0 0 ] /a << /s /uri /uri (https://orcid.org/0000-0002-8487-3575) >> /h /i >> endobj 1 0 obj << /type /page /contents 2 0 r /resources << /extgstate << /gs8 51 0 r /gs3 81 0 r /gs2 52 0 r /gs4 80 0 r >> /colorspace << /cs1 83 0 r >> /procset [ /pdf /text /imagec /imageb /imagei ] /font << /f12 3 0 r /f8 87 0 r /f1 106 0 r /f3 109 0 r /f7 114 0 r /f10 119 0 r /f13 53 0 r /f2 128 0 r >> /xobject << /im1 8 0 r >> >> /mediabox [ 0 0 595.276 793.701 ] /parent 61 0 r /rotate 0 /thumb 64 0 r /annots [ 10 0 r 11 0 r 12 0 r 13 0 r 14 0 r 15 0 r ] /cropbox [ 0 0 595.276 793.701 ] >> endobj 2 0 obj << /length 5586 /filter /flatedecode >> stream x��[�r�f�}�w�i�� t ͼ�/n�l�ݶ�vll;[email protected]-�m4�z~�ǚ��o�������ɬaj��^�!( yyy9y�gg�.��uw_=���]�gg_�cu|��( �$��#��]&i�lz��4lss|�<�k�'?_� �x����:.�#uܕ��(��h��������,��q�ye���0��|w�pr��4�~������*�e(ߍd]u��q�&�&�]��*��yϛ���έz�a2���|o9m�%��$�b�'âq��gufyl��q�w�ݚ�$ym�4j��]�dm�j�e����h"έ��'fpb��y� *c�$�l3ړ͏�����:~�}��2�$��һ�򋤴�8rb���զ��(ta���”��w�y�>u�b��t�-y�n�:h��u��vnbҡ� _�q<"�/|����1dbq/���f��,̂f��� ���p��2��e�~��n�렖��}?/z��kae���,nl�[�uyb�{�)�� ��4pe�]27�����s%�:(v<��x�u� �]��0�ξ���g t��{:m�3��1l ��c$gd���th^5�i��}�u0]���2h�o&��)h��odj�o�3�x��hbiz�obon�t�9o�� 3_jeo �%�4ߕ��n���5(w�۳�lϲs�k7v`�t�ֲ�cs:2��04i��ib� ����j�a$ r���n���o��j�cac�p��ju��� � ��s����di&�6(',r��r�dgi���ka3� f�}�ι��f-tf��&��^ιr/-io�v\\���u ��l|�s�g״_��4a�������q��4��ʮ�����\\op2�ˆg�([�,m�0�s�l�?��g7���na�h< ax�����9���hu���:(fַd�j�/h!3ޝuwmqz�w��ml�s��b���_cp�� r��<���he����c3d��.tx �ى"v�`�3�5wê ���єu[/���u�=r� 3'�bj�#�'���b�/nd,v���)tny0۴"ک�-q��z4k������8 �����8gb!0z�o|�� f��љ&����l �cl�ȱ�ve%l0ͻa �seța�(��^uê}�=�4�#�hvܢ��}��i�(��3uf���8�ym�w���$`�'ڿx�6�uw"��c�{�t��dg��\� �or��bav|��ş5��i:~�$8y�� �������uut5�y��@! f���ɼ����h�>lt������ '] hb� �x��^�$�$�vw2�*�l%�_i"y��j!����1]��k^ɲ-Š_ot���u��'{��shc���i%����h\�il��j�m�]�y���u�~hڥ !�<�ǔf���� �i��l���㋃�"!����mts�k��3wt����@٫gg���%i�p�nr�o��^��/}?��#�����&��������b"z$� � a�6¤zv-p��y/xw/�f|{������. ��y3��%m[�ݙ��'$��!"�� ؔm=e�!�$ox��i䖵����y�3��� a���~�l[�a�0�_���(|��_�.ˎ#���a 6������ �ln�{�2��h��w/����m {��~�}uv6k�.��?w�ː���jvv��bay>8o:����o���o8<;u"��u���|����rj����d:��awz: �3rh�qb�!` ]��9a�'���i���� �� r�_w�u�y� fղyu=�l&�.{��������#|j�&r�0�g����#�pv��)ƣ������dq>x���9�'�x�� �f��"�`���s��|ᨲ܀�<���d'�㼾���yʃ�f�g�ڌl:z���j�}��mx(}ytu�hͺ�%y��f�[email protected]ݵk^jcf;�"�'�y��8�쐤(�j��?u��|��m�d�n��3/*u{с��r�˶ǰ����j�h�o�2�c�ֻ�?�"������p �s2 ���ʷ�z�۪�; k#� 骏 �h��r�"�t�w��a�vv�k�f�n����� k �m�q*�k�yk���a�f�0s�dȇ̫j �������wi�u�a���l�pt<\�ŕ�2ߚ�d,��`ِ�cg�����5 źh�8$��[4h��ɠڨ�8�{�`fk6ib1�֝�nk o�:,�ƀs����4��68�},�y�e�g�ې�v��̄�m(�p�d�\�b��8�b�d�qxt��!��\]�$����}��u��� �÷kշ �h/\�}o���i��u�-� cy�ōtdy�am��q��h��@��u��?�� i75�l��a:h��թp�pq����a�oh�i�y�o���m�lq�m�y>ea� ��4o��vm�y4�na-z @0��di���cc�]�5�'��7�s؝a��!n�\�>�v�a���l���.�)#�p�̓(�gj[j�^~�a�g����u9?�q�kis<ǩ�-���ļ(������e1��r�a�� �f�s���t�9�� ���9}�`t;�χ"a����/�m��y-�"o�� x=>�� 7/�|iv�›a3�eӊ���%c �ؐ ���i�����5����־�o�2>��g(�d��@��,�����o� ye�>{�n�^s�wz�z �h�s��]���΁�.�o}� l�k-o7����"��p��[: �evz7}o�f|�j���]yn sht⮓wcv����lt?����bs���q��p1����wp$���a�h���z��%q-. �t��ء�ч{%�{t(��b�p�rr_,��'a��ͳ�7pw�$هmo�a cԝ ��ii$)%ý��i�c���c&��_q��nل6�y�oο�"b0�!� 4m�`�y ������\�� '� ̽�y$ >ˈ ^ г��� i�n�7�<���a�`���l����v����^.x:�ds���49<2�6���`�<`�َ�\��s�n3$�e��"�^/�u��*�/����p�op�r��r1�rq�c&o��ɘ��w��p��s�eu�xl@��r��swz��a�'�&�����d�;·�<��)�$��i2�x�5���\��h���m�� )y:fޟ�3�~p}��es�}%k���o7k���oži���ř��)y��s��\��(��si ���h�r� �]�^�i� g����f�6,|rv��%�1��=z�����wkv��r<�v�yb�o���q�9�,si &��>��3fހ�:ٝ���rh)葈ǎu�3��w�������18�8a8:�#�!��7�a��u�@�aw�>_��k�k�xf�kx3#�uĩ��?������_�}hm[8)� �"5�ƌ�g� o1 ��q��$ bd�7 ��m?��1�oł�v��d% �iȷ_ ��� |ui�*�c� �eth��hkf�p�v�z�t�ls��l�g�-�ki΂qc����^�i��^�h�,���oî��ѭn��=ʂ��i��poz�aiv��z̍��`�o0��ư'ܡ�t�� ��a�/�ɛ|�ipn���t �[��<�iƣ$�����a�$��m��ĝ�4�����(�)�u:c��f�!q��ц7�w �9�c�?��ad;�*2h;a�^��iv#������)p���"�v�?��̇khh��r 2�ȁq&��#égvha�h˙�?��ē��rk;��fd�pn�uq�h�4 g��j�j��q� >�����%w�m2��=�6�v' �#`�龒�ȼ�;��ũ�lsg�w|~맨:���!�ԅ{r`��c�.(vno9��'� ]�{�3�bvy���9��<��y8y�/�����r�"t�w�-/ �m�68�a(i�υ���o^���� �����������5��*td/� ���jj��[email protected]���m\���w�_a҄c��xu�s�l��~"\��u���g��'�1�v�(���%lxʟ�� ���p�t�k�_&� �bظ�w����� endstream endobj 3 0 obj << /type /font /subtype /type1 /tounicode 4 0 r /encoding 5 0 r /fontdescriptor 6 0 r /basefont /bmibha rmtmi /lastchar 60 /widths [ 780 ] /firstchar 60 >> endobj 4 0 obj << /length 214 /filter /flatedecode >> stream h�tp1n�0 �� � 2�vvë��u�]�[email protected] �<���7e�#w�l���lyf�{ 0x2��[x#�p�e��u��<�(��9���࠮����9� ���:{��l�-������h�����4`p�=)��&�u�e�u�������ȋf����' ���_�m�w��yƕqwc�*�j��._�#$sk�z�w>y�? a�ix endstream endobj 5 0 obj << /differences [ 60 /less ] /type /encoding >> endobj 6 0 obj << /type /fontdescriptor /flags 68 /stemv 73 /fontname /bmibha rmtmi /fontbbox [ 0 -213 987 680 ] /italicangle -14.036 /descent 0 /capheight 0 /fontfile3 7 0 r /ascent 0 /stemh 34 /charset (/less) >> endobj 7 0 obj << /length 266 /subtype /type1c >> stream  bmibha rmtmi$���jo � ��i�o�<�f�i��yin1000炮捕鱼机 copyright (c) 1992, 1993 the texplorators corporation and y&y, inc. (508) 371-3286. all rights reserved.rmtmi �������������i�y�i�f����s����t�y��!��������v��g���� � � ��  endstream endobj 8 0 obj << /type /xobject /subtype /image /colorspace /devicergb /filter /flatedecode /metadata 9 0 r /bitspercomponent 8 /length 413485 /height 566 /width 2000 >> stream h��{wxu���� rb]b�jz�b����rd�#]� �wp�h �bj(�h�)%��[��o�srf�$����~��^��;wrge�u�^���1 ��`0 ��`0 ��`0 ��`0 ��`0 ��'������s�z�����;���)~��[�����=��xת <w �f͚ jfo&��l� blяćͣe6t,g��!k�dɹfyd���s�(#g�_�ӭ }�(��r,>h�vvmy�m$�'j֜���z}�ly* ӈ޵���{�me aʼn&3����dx;z�k �{:�<��t����5$x�.}0(�����=}�0kz!���w�5;ȋ�p w�1c�h`���ki1 {ŋ -�h��u�֯_ٲe�ߞ������?�`0 ��`0 ��`0 #w�׿�5z�贴4�o��a�"e��g�}v>����m�>��т��;��ݿ� ����c�j-- p�j���s��f�!s%†"g>���lb%�s�=g�l<3��jl(�xx�vnyy�ez #��#��t�cw'�ey����0�d5(�g�u�e؄(�j ����u�i{�h��^y�,,��z���܄�x]b�_yldxp3�t��,�@,)딡�a�8���y�?�����4��ѿe=��2-ߩx�p�“'onoow���e�r���t���<���$�b����i�`�p24h9����ien�9{6n�� ��"n�u��  �ex���p3�d�r�>t����ldy,ov����_�z��­/��i�ky� r������ q�t���8�%!fh�-a�.ل1��zb�����a����y����3��$22���b���`�޵'�p��۷oc���ddn�޽)r5jt��ѵ�4k l.�b�����0vww_�l�xݞ�(� hο?ߡc77�� ����1#�v.\�ر#��ŋ#��"����ؖ(��ŋэs��e����> �h1-c���'n,t���\�r�6m�yn)r� ~��0fu������`)�ڵk����͛�w�� h�y�����)�ʔ)�z�jn a�.\�-[v͚5�:q-4�¤�m����e�}�t���?22,xp�hh�������}���۷r�j�6mb6��ׯ�ٸq#�!c���v�ʕ۳g"cٲed)���3!2v�\y�xq����k�.&dƴi�3�ƍ{���!�ɓ'�g�9��߿/�����r�j�m�ְ��?~��8�w�d w�ۤc��m)���r�$''��ݛ���͛��0���@�u˖-/\� �k����zr��#e΍7фs����_�xq}�c=�=�����ׯ����0���w����"�[email protected]@@ŋ׭[g/rx���iub��#�,66�k�. g�ڵ3��4��ڵk������v�����wios� w�4|�2­e��v5m�x�3a�$ԑ!c ��֭[gffʟŏ��q��={�xzz������*��29��� g<�p�m�ԓ$�~���95k�d�?~ܶa�w*�ݺu��k��k�m)9b��e��k�쳖$�i��:9�{��%�v��0f��۳goj dιs� �e�2 ��otr���$��������2�tp��ko���޸qcy)�̊�� �r�ʚ5kh��߮?ْ¢e���㨨�.]�t�\y���3 99*tx�l�h�l��9�յk�@���;�q&ų�n�h����çӧo~��}�6��9aaa�˗_�x��b�1��q!��rss[�h���\�h�9s���pg�m)���o߼y�u�'g��dμy� ��n����o���l�2_|�ž{��l��@�,��=�z�m�v�3n�8g~{ɒ%��qv(l?� ���޽{�r>qⅎ��rt ��ԩs"ؔ�,ɕ�;q� (~{���œ���_�cb�k׮�owfmmh�|�4�,�v=9�h z-3�u�'~&$$��ٓ\s�a���x���ӵis��.��zѣe� *y!d'))�o�>9�����'y�uk�γ�s���j�ӓ�����g� rμ9�i�$��^�j����?�އ�fqoa=��8��"&���aaa�0�� ���y,�}����;w�t�ҋ d��ӊ�az�/_^��r��8�h�u�k1�� "�}���r�aۘ���/y�����p��[l�q��b�,z��mg���ioo����7>���>w�\��˖-�e�it�?�a��~;=�pssc�x[ar�e��g�u�l��c���nhj[���sd�q�3~�����jr)��u!߸��g��7l�p��x�=z�l��b�"w>���o�& ���k���!�g0qqq(�� ��ow,2{">>�g�䚶j�j��5��l��[5l�[bbb�޽i�y�f�ϟ�s�(�����x5�� %''��v�o,m�2,,� *r�_�.��o��l����رc�j�֯_�o��b��qb���t�ܹbŋ�|��!?#9�:u���x�j�$$m6/u�]�(ϸs��c�h�~b��ç3f�(\���ogpq�p�|��k����ucf�1"e���}���v���y!���1{�l��]\\�kj8�l7`1�;wnѣe��v9�9 �֎qסў?>�툜 6�6n?�x�?ξ �&"�<��{'�1c跗*uj��%���ve��v//�f�����<��ؿ���w�ƍ�o�݄x��6���i��x��o���߮骚��xg~;7&~;��cs�2��\��iii�o����y��hll�۷/�����p6 �^�������tx�9��kܩ����|;���j׮�������z�&�%'�|�������˗/�p�e9�۷/_���u�d�� � �~�̌��v9��}ǎ\ pʠb�ڵ "g��)l�ɋ�n�mbo�u�����~��v�o'ky9��i���3g���n-'`�)j1��eͷ9eʔa�]fzz��1c\\\f�!������˷��p#zn���r�j�iӆ�v|033sy�,�k�!7z��v����ldjժr��.sg�y�qf�?���ziҳ f��ng~��v��@���b������~� g~���y;`�aˡ]ն~;� jk;��rt�~;ҋ�v���:t����c��3�l �x�b�� wr�h�'lhgȑ�v4v��c7��v�6�toy,�yr��~�yri� �[�n"r���c��<��$/��vc�~{�2e�o���]�cam���vc�4���# 2�lll9�6i��… 0rz����t!�����o�rn�poncz�o�=bbb�����r�r�p�)��� g�bb�������o��b����� 6�v�[email protected],娐�o�i5g�j e�����ow�y5��;��̔���7r�h��v�[i��m�t>��nc!r�e��޸qc�rfhy�r�f��~�}t�0�4�۝��v�߮�#���\���ӈ"g�����x4�~�f� g�fk��v___��e��^�be��|7��y�]�hsxʝ:urww_�z�܎q���} !'��9�*d����k��0i��x�� �o7a�~�}ҋ����9,�1cƹ��>\��v�)}r��<�� ٻwo͚56l�~����7$gd�m�hc�� e�=""�90�ە�g���ջ\s��e���ݻ��3��μhyjr�ow�������{xx�[�n^e3�m�e�e��m�*66��v1�����3zv����u���9 e���aaa�˗7�o�9e<�n��[email protected]~{�"e���]gp�,��x�b�둖�6z�h�̰a�dkٶ�"���܀�����΢?���a�� x��췛��v�b���o7��9��v�[f��$��o7��1�~{� ��p�����n��m�~� �o7��&`�=7`����~��(��ow��m�~� �o7o �۝��vc�ߞ#�o7�e��mҋ�v��n3��h��&`��췛��v��n��m�~{n�~�s��vgq����������n���ӊ�vg`������mn��v��b���� ��9r�~� �o7��&`��췛��v�ߞ���t`��yi�;ϸ���v��n�v�;��`�=g��nr�췛���&`��0f�oϑ"��m�~�!�o7��&`��췛���܀�����΢hc�� �o7��&`��<��ow�� �~{�`����o7i ��m�~�a̰ߞ#e췛��vc��n��m�~� �o7����o�۝e��~���n��m�~�yz��� �����~��-��n�v췛��vøa�=g��o7��`��췛��v��n��s�۟ �;�"��v'`��췛��v�b���o7��9��v�[f��$��o7��1�~{���n�� �~� �o7��&`��9��[�����9k�pٳgy�'o��s����~�!���������s�� a nj�gdd0'qqq=z�~����~;��i�~�3$''���g��la�ۉ����nr�췛�ulllǎ���w�^ͅ��� cf�۷m�ƒ�p� ��v}�0w�;k��s��n���l�۝�#��6l�hmm3f ��hoo7n����ݓ�z��a�r�z�n����pٷo���w�ƍ�o����5k�9aaa �<�r���4h�~����ԅ䷷l�����̌@||���aϸ�hjjs�m�4a�]i�>}���n�o���grz���ϗ�v111:t�x������own966600���cժu*jz�z�~�qqq�;wvww_�|9�����ʕ��v=e��h �o�#11�{���˗_�d ��rz}���� bz�����.����߾e���er�ϟ���hmm;v��������ow ��?��se�=%%�`���7�z���y҇ʮ]���{{{���r�)ؽ{�!9<�n�o���>�]�vd 6hѐ]s׮]c�n�4l�0<<\�m�(!!!00�ȩw��ٳg9`ї�����!ה��>�s��d���ϑc��&]�#�3����f͚�*uj�ʕ� �ݲe˒%k.y��cei����-z9�� 9�z�z뭷,x�lh�18a„�_~r �ټy3g�b*�m�"r�͛gx���ު}��o��������s̈��>}:���o��v�z����iӧ��� �r�o����� ȁ��>>iii#f�(v��'�|"�p��n�|��� g���|{jjj�ф��.� �ܹ��ťz��!!!6a �'�ڵ����?~\��� �\�rժu��?ln�����֭[����ь)�3!66v<��w�޹s� 3ԟt!r�m9�k��a\�c;t� \s��e$&&v�ؑ����>}�4s�i~{pp� gy�m���h__�%j�q�f����ӥi�7�xc�…*j`dee���/^|��ŭ� �1�q�k����������1v��^x��� 6p�(@�ܢe dμ9s�ڜ����v�z-z��.���2e ��z���*�3333'm���/��՚5k���e�ç�n�*���x2rss�z�`��*�2kqzz��_~ r>��;w��oa��w�>~����d����o 4h�ȑ#�\���&����g�����'rf���k�k�-o�>=x�`$?ƒq����ӧ7m�����jd�d��͛3g�$rƌ��"7i��mg��ic%q^t^q.h��ld�^d�̚5�y�� gԨqqqqʟ����e-�v �����,rl�?���������믙9�p �=o֬"unttt^��z頌��c��we=iii(������o�����|����oܸ1y�����8p��ii ,� �֯��ʮ��3e��uppp~��6g�t(�s c�ѣg[�n�ԩs�f����b9���s�֭�s�"r��ݫ��?����v~��={x�m������;v�ذac�������}vr�r�o�n�ӫw��g�� g>p���n��a޹sg`` �s��a�&���̵k����w��婩����,�>\�n]�޽-zd��r��� ���؜%��~������:t诿�ʃ�v/kδ�(wszn�l� �g�[ g߾}h(rd�]���h[)�4g7�>���σ�󿈴�����͛7oܸqh�3!==�ĉ�6m9g�q��e�џ����?��‚c�"� y�_�/b9'o��ܿ_�vt1�c���u�ͭ�v��-[����y'r�[email protected]�f��39" ��yæ x��޽�׾�, �hj�c'л�ej�z ��lڽ{w\\�i�w ue�b֎�!!!{���x��9ǎ��an`�9{�쉉��/�y�� j�e'�{�\�����˗/o۶m�������$�t�j����[�m!r�9 �4����?r�v̌$wtt�ծ]���~*�fi� /�lʄh\�z����_�9�j���vsx�c��}�v�� '>>��j���.\�ڜ={�w�(! jrה��ݙ:�ie(k�������ên��a����m �����.��f��侒^ք�s^�k�p���"u�bg�����]��#d�r���p�d>�q�2,�bʓz�ٽ"v�3wj-��&��t��,�ٮt_zc�&{m k��\1ty ā,j�ch�[email protected];�կ?��e �i:�5m�c�!�'}����r4�𑟀ܔ�"y�����*�`�a�w��ltbr'��o��gff���(�\" 9u\}�o%�|�c����s��u�͝�fs�g: ���颓�e �i����c��qcj�:�����m�$�l��]���i���u#o����d��2e�g�ag]�3���ڂ�����r�i�c���e"�e�b���r$����!w)�v�> 7�yn�g0�n[d:;۝��[�zfs��ư�1a�e���wvt�/���`0�c�[�e��t;}plu����tw.b8z�i�a��<]�/ �� f^���^�r*�>���"�)�|���!�xr0�)&?9�����wgs0ym�􅍬q���ل������։ g�����:���g0yv�͑�յ��j9_�e���d{j�%y���9� ���y f~��*œs��y�@6õf�d��| ��-9�x��]�g"�9i�|"�a ȭ��� �����8v��e�u�z��h��٤���$��jhg����k #�2m��=yo�=β�ixm׷�ͦa�����ɏ��͝ ��h ���g�h6���r��k�y���q��1�ɝ�hwv�hn�t� 1��2�n���g�>c��4�muy��&6y���e���~���v#�ʋ(*�΅����~�4a��x�o�4'~;i�9�x)q�0r$����r�1 ��|�_�n����;��� �8�����(���w�xм�tj&��]�v‹м��t�=[yd�|�i�2�'t��fl%v��w�;�tcl�ѳo^n��>g>��_ f>y7�ff9s�����r�`����p"�\֢�� yv����t84!�e�<�� ��oa�n� <�d-��(�<)j�qqymz � e��?fϟ��w_-y�$**j���t��� �"�^φ��2��pg[����\�ęje��������ѣмq�f-[�,&&f�2�� f>%�w���ɠ�� z�� �:'==����s��9r����/]��l��#��pt�plnp�"�k*�&�ybp q�ϟ_�|��q�9!!!�2��v#�ɋ8��d�< �[^˚k��} �^l�����_�z�ĉ�̙s��1�<� bc�2w�`0�r���3��߿�����b`�qs-�߻w/22�ĉ(�ν;���l�u '�5��}������3g�\�vmit孔�w��=y��ԩs[�nݠa��ç�on�d0yg^d�]>�ލ7"""�א��ǐ_�x��m��'5����x�>p�c/;� ���g�b��9111���b��/���4��6mz���7n��_�3e���ȿ�����8u��s��u���ݞ� 1�,���4j����=��-�b�h���vhs��s�qza�fμ ͩ_���a� ����e���w�[email protected]�ν����7o��0��'�hɔ��>�t^�5�e8?** b��i�h� \�hq���������{�n� ���f6o� ��<�.]bouł��hejj��m�-b�d�uxx�d5"_w�g�q�$&&��9t��@s�e�,y������������h�h8��  �`� anqk�z�����,^�r-� ����� ����ʕ�]���#bcc��şp�֭ 6t�ڵjժ8����8p௿�*l0������ �0`@ٲe_x�%j�8<<���3�3���f��<�@��l��̚5�m۶ vtuu�ԫwoذa��w�ɋra�[�l�իw�j�p~�5���gϟ�w�j�����4g��ʕ cy�o�.�c�{��$} �o��'������e� ���~;���uh~v���޽{���|�a9����khh�p��?�1ͱ�n߾}�}hd ?�??��*y�d⣂:x� �� ������֭�����e?��9z�(>k�s�h�=z��� �{�?�`�;�u2zҥi={����o/_��e/p������?�f��n��okk;|�0j'ooo��^ ��ƍo߾m�іae� �x��q��w (�ꫯ�h�b�ν���_�`�/��^fna�\�2u�t___* www�d�3a„'n�o�4g݂^��?ujhhrr�podioog�2|��z�j��j�*u��i͚5�����f�w�z��i�j׮��k�av|||6m�d{j��v�d�s��`0�;��]�~:k֬v�z�(q�b� p戈�@�$w��8e�g�}ְac�lh-===�� ,�t�0�d;�r188x�ȑm�6�q���ϖ-[bq��s���3�u�>���сc_|�e�*u�����a�p �����`�5y��/�p:�tcѵm۶�'�i�^�zٲek�,y�n�x��)eϋ��gs���q�f� ���#pc��9" 6�����ǐo�2�]�v8$>��� �:w�ܑ��x�(� _b8b�([���y睁�9sf��g�����*d��@1�z�j4���4�p������e����(��?�4��ɓа6m��|ҝ&m�@cđ��u�h��78���cy� kذa;w�$�ѳ�or � ��믡9�s�z뭏>�(,,�>e�~;���th�����׭[׺uk�2�(ν;�h[email protected]�3~�xh�9pҝ�~�m�z��ʒ�3gbs��7n��e߾}蹨&��m~2��h�f̘q�~�"e����먦~��ňc0y_a�s-��9�}^~��g$ �?��stfr�u �:j��4k�l�ȑ{���'мٳgw�ҥv�z8�jԨѐ!cv��a���e��jqqq?��cӧm�|�m9p�-[�p�&o�&���`0�4������9�m(���wߝ0a�ŋ��.�#d�aæ͛7g���-&&fϟ=sh�g�}�>2 �^�v-zo� �f�����d�ףg���o?���}lqqq ,���y�&���y-k��2g#�@������.\ؿ?d#!!r�k�.oŋ{�7>���'n�zp�c����1m�4{�ȱc�f� ���ą��6����]�����(�9r��5h�(�z�r��ܵ�o�jp�&&&b�pv�z����v�3�h�(�߿��ɟ@���/��i)]�44d޼yׯ_פ�9p4�:t�[������qh~n�<�ak���"���ç�w��9g���м9s��|�-�7o����m�w��>|���bŋ�m����rnq� ����hs<�;p�@�ν *t�d �j�l!�q��ja�u��)hмi�&5h���}�v�å@z��]�n�!c���a����y�&m5j�b��╡s$��ݻ;w�d�� �ߺu ϸ3�n^�� ݘ1cf͚5 ,�)\�0�aæk֬�q�|���� իwoԨq���!aaa�x�f�ڵk��?޻wo�kp$t&譠9��ߺp�����k�,�ĥ0r�de ��ʪo߾��^�6mp}��h���}1 f>���4ǘıcǡ�(�j׮ �vss���o�|��{x"rĉ� w�ҥ >h�߼ys�ܹ�\��ڵk���›����e]˖-����bfqjk___�tbb��w��� y{{��'b2���l���w�\�߾}{����j�by���~��[�niyf��u�6m�-'�[email protected]��lق�cvbcce����r�~}�k�.6 �:xzz~��71��bl�s׮]h�q�0 44�\d�8d0� �*�}��au�9"��q�l�2儇��g�}f;��ŋ�]�6l ��o!�۷��l�6�ҥk����j�f�ї�4�����p#�űcǣ-}��!n6��ů�ի���zr��ht��v#�"::z��ِ� �.]��/��k ��ݻww�xmao�!m�ϝ;w��b�3y��w���"�u�v???�4s�́�uбu�ڵf���yxx�yu��.�2dԦm۶?���� f~�( rrrpu�3&((�s�n=z��޽;��d�s��)��t�z��a�����a���g�������1.�i޼9j#�i�b�gϟh�� v��i��l�� @�5|�ptg(���q���� ��}��pz�qeɇ� ����������4�եk�-z���.\� �e�=�tĉ�8tbj��nw�ڵ|�$�ϸ���'��:@�i�7��*�k8�z�j���;s� ���� y2a�2�-ghhhhh(��a�v���e˖��suu���o�=j��_��y�f�rhbg��eu��y�f5mڴy�fs�υ��<ػw���qc<��� ���˗c������9 �����d?� �u';�k��3y iii���@ld�"�і~��g(uڵkw��!z�� ھ}{߾}�9_}��իwŧnݺ������͜9�fš9�w���㏛4i2t�гgϊ�� \���-0ɗ&��j�c�~�nݪ���<�� ���t��� ��f� ί8�(*"*8� � *⬨�yb�8��,��� �8��8ϣm'���{�s�ʮ�l���[������=��{����o�kש�s����bu���&l|��қ�-> �if���ʕ�y��رc,/_����g0��������=<<`�����߿�e���çg����t��i��h�z=z��xm�>]�#�k������w����[email protected]��?��ob��e����ξ8q���ohh(v�͛7r�!�n���۷o������`nvv�� �f͚:��ٳg߽{�r`�rrr``:t�μo������ӭy3�/�?y���6l��cǎ�;�@�pƅ ���4�*�)q�uժuc�!� t(;s� ��e���}��� ,/z�k u�-[&o?sss�l��,dfgg�g���"�ڵk۵k���}~����d?�c�c�įꑙ�c�g�˗/o�:ip(�z�jխ[ת�~��m�ӷm[�|������ճgo�:t(~��ب�7v�ܹu�ֳgͼy��#knn lԨr ��vee�9r�������r�����qes�؄�m!i���̀�<����6$�\��vl�`�i��j�����9������q�֭�ر#������k�#eh�n���u��t6*&�j��aݝ;w����՘��6��c„��7�ګ䈢��k��էo�~��u�w�[�lqvv�� @����/^dggdn3f̝;w�k߾}hb�r��9]�!������s�re��ŋ�t�jkqqq^^^nnnç��>d6�ebbbzz:�g�z4��ot�����a�޿ћp�4�s~> �l�݄��)�$�����"��as�n�t钀u�t�r�w��q��3 ~����i�=�n.^�p�o߾\�ݻ7p����ӧoc�jժ�i�n�g��dq��ۥ>��1�s��٤�$�=z��իw���_��=~��>`�{���ƫcߦ�e��o�#���g�,y�v`��m����sob�ڞ��0d���יch�a�����x��e������d���gppp�5`���a�t�h�e԰a���@�)�i)))0��a ��_�-�s�?yyy0��pn���������q__�et� � [�~�g�t1��~��,\�pժu�v�0ab�f�jժ5r�h��[~�{{{{c|�x~� ����s>�"��b0 �t/xο??y��5k����޽۪��_x� ��rrr�6,�#{���4�ɟ>} �o�ΰ��>y�d��r�1�[l���8�q�y��n�:}���\�jutė-[hd%kt��̙3����*u���;t�x%�90j��x��5xq�r�ν;�����abr�ĉ��e��nt�b�ek4b1���s�.]���a4c  �@�h�48���u�!�`tb<�ܹsh�r:x��c(d„��7�*?0y�ν{8c� 0�\��ú�˗��z�ꅅ�a�t�q{|||���a�����"j3 z��ԩs!�^���o222p�����fދ��/�ݔ�###ӹqc�/jp����el.�sݺuz�]� cccׯ_�o�k���ݛ�"^[����)��� ����ҫ-�[�n��-[�x�bzd�m���fggr��e�i���1c��:;v��b�3���mpp�n�����0e��֬y�;vh���'�-gj�o����ٰach����bcca����o&t�w�є���7�t�c�`��iн�gâ ��3a�w �mail protected]�?~���d �a=zc�h�>488��n��rg���]�be�p����)&\�t �s�v��͛���#a o�d5 h��q�f����8��x� t y�r��%�}�6f�p�ٳg��… � �k��\�-.��c��bufxb~�u ��� ձu�v2�|74lذ��le�<�7�1�̙3�#u�g��ɓ�w���o 33j��>}��|�z�h��ͳ��#�-??_�y/=1�Šl \dgg� ��0d�ܹ*4�?x����� ��i�&� �w�^xf>��t��ƅ�� ��q��)]��g��'���ѭy� ��ƀ-����߿?�jn��w�gr�������:\jnn���v���c�?��ķb��<�޼ys��ҋ/޹�z��֖,y��0a�b���-�@9anll�0�v��x�5k�p;㹷^�zŋ�p�b``�c�����ń��"=��2� �gw�~�f͚! ��~�i�œ�u�������ծ���`hjj �[email protected]�!�b�… aj�&�� �xr�? l ��`n�b�pj�!�z�.!!aԨq|tz�믿f�3g�d?0��e˖�۷/ì�u- f�0�~x����&ye h0>�w�f�ܽ{w���p��&�/^�(s�3>www�ss�� ���ν[�v-wwwd����f��s ���ke���er,�u�v� }��&�?>x�`�^�ƍ�m��m�6�iр��dɒ���x��u~~��s����[�jŗp�0����s�lni߾=2 �hj[&l���8w��ҥk��&�����g)r�w�^�a� �j0g�ر�i�ȝ���p{{{���ٳ��t&�r��x4� �0gŋ� [email protected]��e�e<�{02r�hh��60bj�a�%��� �l��۷����!���,�w�-z�_�>//os5jji�� �l�0���xo�z��u�����[email protected]�ʘu��=|�p/�q;:0 @�e��>}�iӧ�͛�r��^og<�gs�3��[lmm��e� /����(w�ԝ?������q�ԇ j��q�f�{�ҥ�ӧs�@�bx�с;v𑳳3�yek�3�����m��o��3���i�q�)׿��pd��qru?n=��i�&��py�b|hbb"$�?hh>�5�^�"�7oެ���w��.�t�r�|yd$@�œ�;w��0���m6���5s�l���g�}���[�^�dijj ���ٳa`�b��ׯ���q���b�� �g�� ̛7�iӧ�j����o�����n4 y߲ek�b�[��="�����-&&�����q�����k���ce�֭[h&$zh�5��x�v:����u�b� sd��j/^������f�u��͜9s��“�%�( -gt� ��9����gl�d� �-[6w�\db���hܸq�ڵg�q�� 1���ڴi#����\� �r�p\ڳgϋ/�9ҳg�*u� <��ٳz?��ۗ/_���jy�v-��_�������lllp|l��qp�b�a���k{{{ȃm�}�vdd$� x��o�w�[ݿ��ç� ���2e�t�ti���v'�m�0�x$�d^>|��!q7�-�ի�ezݫv�:e��piii����vl v�v�z͚5����!g�eb�8p �h�f���ݻ�d �7œ����ĉ �r�ʶ��c� a�0d�޽�$��}�:u*[�0�c�%k���� cbb���^�i0�t�ti��0�:;����m�0a�� �ğ\�l��\]]��8 r��g��!*�o�ʕ0v/��y��ֻwot``` :��ӧ[�li޼9����t�a���l� `!'�ab��0��,!<ٶm������a j�=>>�y]ݺu�?�g�.\ogcj��[email protected]�;y(c~d �t��[�n�vi}�6_|񅛛[tt����!�ʸضm[���}nll�s�$$\�f��ȅ �����]�v a�[�ڵ���s�r��ݻw���@ɉ2!�1��/t7n�ŋu�\�`�iժ����_�~ s����nĉ0g�m�$�n�z�`a�ڵy����n�!�vf���mec{��i׮]�b����������m�6|��jrr���o�2e`�t/�y~����n��{�ej�jۨ�{�6999�fڴi�9]d�̙өq#{{{���˗e�0_c"���xվ���h���a9y�$� s~��}�ҥu��mр�ƍ�3> �� r��߿r�jx�3f�r[email protected]%�q��… �ubb�сcj�(r�r���j�.\��.lפi��zj��o�l�0��ȫ�ib h��}����|��g$22��۷�kr����;œq�f�%�������ϟ�wjڴ)́!ǐ�9�"00033st�"ɽ{�v�xq�^=���q�l�q��-�b)������㳳�է|�*���s���,�!�ҙ�0�|9k �䏠��u,�0a��o:|���x���...���b��r��-z��j�������!|zzz�޽[email protected]@�ٳg�x��u���ƽ�<���d��w�z����������/�������h��1�l�}��a���yxx���odrr����s�ne��3���{˻��m�0��yg=g�"q)�]�j��ɓ��ݫ���l͚5 \o�(ft�w_}ŧm۶��0�k�.�/񳺆d�[�na�����h�l���v튜cn̦޹������q�5o�<�):p���z��~r"r�kϛ5�� vč� �ta�ćf�jm����kr���]�vm�8�a�e�)w�܀�;&��klll�v�p�abuo�z�*���n�:>>^�� s�yo�}����a��͛ك�j��v�a-�����<���s a*6r�b� ̹q�_gٲe���0�������ja�0��w7n�b�z��6a��bujoz)�j~~>&eɒ%�ӧo�aې� 6���;v�*n��111mڴa��yyyz�:sbg�o���iѣŏ;�9'n��ٳ'jc��ufy �ҥky���aæ z�]�d����0��z��ǐ�<^�dɒb6p�m�6???�*c��{^o�ڵnnn%j��ӧϩs�t��w�0�a㇂�����wdff�o��`=/^���k��hll�7�[f�e՛"n޼ ��ގ^b��ooo&a/)�)�ܿŋ�愇��fu�ny����ç3�e˖0ψo� �"̊/޿��ٽ{7��~ѣe,�ƿ|�r�֭���ŋ���!�at�v��-�snii� c&l���c��;�����'�|bgg�|�䵻�;h���,>��ξ:u*dj׮����q8�2� 3r�ȋ/z1ߊd�]����׫��n��g����ѣ~����-�?|����g�ҥd�f2�w��|�� h�;�����޵kw����}��'m�0���r�li�;j�d޻w�ݻw�x~�w�xѩq# �e����m��l�8177תw�ƍs�̩y�&��c�=���9��s�ή�p����s988�z�jj_vy/�qi��p���ك���`'�'\�*55� yyy�i�&rӧm� a�8;�e�����0&l|а�}jq�vf͵o����~Ԩq'o���_�����j�*�3uc�'p�ڵ�s��9s��ի�ǐ�������>}zu�e<�y�z5"���w�.œ�� ��i���t�w�^}}b c����:`��3v�v�}q#��h���l䵏����*���s���ŋy�a��w��b�nb����%p5�'o�y�&� ���&�d��֭�p�]�� �o0��wa?ro���wj�egg3� hiiq������&�#� �s����a�5�6mڪu � ���ζ���~�i�"ej�.���d���^��9(�b�����=�g9�z��m�bvv֠a�����s6��s�ar ۱cg�tjì;d�聒�v����tdc_a6�a����;::��"""�^�߿?cƌ��룚v�ܩ�?��0��@�wk�n�zw�� �͙3q!"݂!�q/��)��8u�tpp0d"��� v�=�9/_��h� ���ls�\tt���w&>>��p:u�stf)8s3j�(v�@$(4q�ć ���:�#���ӧ�7�ç[�nav|v��&l�0��ꐲ"2�z;�n�=����{��e:�q��@�8�}�����n�6m�vzz�t�чhk�b�q�лog�q�� �m������p��7=z�u;ۆ��w�����?.�:d/j�_�cǎy�v~k�tܸq���պzw��c��{�j:�2�j�r��7`��ӎ�@je���������o|�c��u4�zzw��աc����m�dj���#g��u����3�p���g�9���î�����d������d�a��������~�_��[ ���������v�&l���cw��uo'=8�mkҥɒ%k�id2�w�^666p_�j�œ��d\������w�\a��=`ύ;t���o�k�k� �^�^���w)�z����̙2eʣg����7�orr�~��|�2��������/�sl�xo��b�u�$�@ր���r��u�x�r�j� w�|�����������_��w���sy�ν#o�� �s(�*55u��0�g��n��"�;v,j|m޼������s����-0g=����x�'�e=�hv����u����,օ-���ڷo�e����l�:���?x��԰ń�z_�u�[�a .�f�>}222�_"����g�z����>|�b�yl��q�&l���|ժu;v �� [email protected]�4h0i�$��c*v�w����)�t�դ�%p�v��`��pɋ����3�u�贴4�v���k��vѫs�����0�q$*Šh�>55����������󝝝�7o>w�\�bκu�`����d���x(hѣ�c�3��8�t*�ʪ�^��w��ѽ{w�ogk锐�y�[������={:thw� �9|�z�j͜93//��꺈���3a��/a�ˆnh�g��p�9b>&%%%&&r^�]��r�j�d��-�&��������r-gi�^��]�vxh���93331� zȑ!p�m�v����6mjݺu�ʕ���p�j�y�g�vpph۶�ν;�?�ݷog�;潮$�\�2c� �7n�8"""??_����zj�ŀ��*�7ķ�~{����z�ر�f͊��a�ay={�,vq�ܹ v������&0���a�qq�b���u�0$..������p ����w�����ˋ��;k�ߌ��\vvv(i �u�_�vmd ��v�o֪u �m������ccca&��z3� &>�pph�k���3���˗۷o��">>^uc�z� �ct�[��$&[email protected] a� �4si�;�e�]� &���@�-[�hi_<`a�x~|�שs't���grr����9��ĉ!!y����o��`��w����5�,_����笫��m�݄��f��g%��2k.ʱ>y������ :99լysԨq���*��9�w�u��a���!�'m�dʃ���hq�(�#�����?>�;w��bq�auow�lg�e666���8,�7n܀x$0&�v��]��ҥk�ej�� u�ķc�u ^l��p �_p�8��v��ׯ_c^�e<b}����e<�@���޽{x3r��ח�f9x �$�����irr� v�n�:) �t����� 6jԉ��3���<�z �2{�l�h999���xe?���e�n����v�ȑ�3� �x�f�0a�7�w�za'w� ��t��c� 9~�8l�� ������s��qtt�b� ����;v,�xbt�5 ��ʕ �7o���`�޽�x�&hg�u��-!!��v�kw������x�d��_�x���d��ç��*��3sz{{�-[���\�`qǰ�u�����0ٰ��y��½g&l��%lq��op_o�>�'4�|��e�)z�(��*_eʔ�<�bɒ%�'ʳ6�#ױx�o����^уm�6{���& �� 6w�\w�܁<�y֬y��d���>|؂�9%k�dan�>�ܹs, �p��;dj׮]�<� a{���7�^�����o�>���=��:4i�d̘1gμ1t1a�7�?�b*1�_}�աc�>|hj��۷o7n :: �?$ƿm��-$,��y�&���-̠��k۶mw��!}vlx��� �iڴiyyy���ٰa��?�1�minec����{yy�*u �l�<v ���ҥk�}�����`rk�����*t�p�f ؒ���x�/}�;wfk��'oz�y�:�sl�x?�hq]�&��� Ԭy3$$d���@'@�sbcc�_�cp;0�y�f���h�����&''�@�p��޽{[�la���� �pc�c=�e�'n"�lll l�f�#///,, �ź����4�<��ϋt�r�\9����`}@��nv6��o1a�c h�'��b�ׯg�g�x!�.f�ܹ˖-����e{v��͛]�vu�ؑl_�`>��&� ����n��@�������x ���oy"** �8;;c��l�2��h�с���`�_�~���o���:t6l6�� ��ԩsuӻ:�nh� l����ǣe�w�>k�,&ٻw����y�]�vldk����g���r�j�jղ��� ��� �y�ՙ� �g���z��^��&l��(\o��3�>}�zc;�7��?|����n�:q�'o�1bv4((if�� �& ���z`a�����h(��#� i�s�nea#�-z�~��ݺu��[�neױ��={2?wмheˏ�v???�s�z5�ȣb�(�ڰ۾}�2���jn&l���?�}�vl��n��u�v���p144큵$�uuh�x��y� �300�aڒ΃ œ�y�ecޠa�m�ah|4҂��<�۷�9x`��u��h���f��y�v�.]�l�>=""޻wož333e�ro�-vvvիw�ի��ŋ�9����z���(��˾�g�q����_*�*r�\�j%k�֮]k�c @� ��|���|�;�<��z�jk���͛�ϟ�승s���'���>}c��t�r�9v��lg:�&s�[���ԩs�<��n����'� ���9묳h��{�9�8�j��p� ��ԧh��͛g�f�c���_o��/����f��gz2���)lե�/��y�$����?�я~��gq�1�crf��6�t��x,�_�^�[��'?i$l��k�,q[i\$�dڑ��,�ӟ��455��h���4�.az� ��}}}d��r�-��~:]��#��j�'���mmm:�� �]v��?�y2�!�袋&o�l�mll��w�c3 m%:]dc�?���~���1�3)9���v�i'��a�ᒏ|�#�ї>dó:�#�q @��6m"��;��'>�i�&]z�d�m۶�]#�x��7}���/��f= i���h�� sq�m�� �˗/'�� _��]�4�<\��lk�u_�& ����n#�č�sʔ)t���o�������/��j��[-�������n"�l��}�c4��3�䣑�d2smpe4�;;;�w����oc�4�3�� ����o�9f4i� [�n%���h"f����s�9�t��h��s��a*����ҝ3f�qe���2���7d_��b���b~.i9�$>�\r i�b�c�,x�`ժuj�9��[�q��k�er�w��|��˩t�t*�?[�ly衇hshmh��\x�䂽��[j���_�r�̙3�d^|�ſ���h����g���a۷o�׿�e�i������x�…;v�0e�x,�]�$�d��b�x��3�gϧq���k�1� ���~��_�f)�a���9v��@5�t��w�e� ��^z�̭h�2�f_4�͒бt�ڐt�b��?�������t�m���k��!dj�����ک�-�)�=��===�im`�e�&�e˖͟?� ���;�ԃ�$�zv�z��|��75 �w^y��;�$�k�j4�#��jsr���p��2�^x��9z�od�]���䎑�)�#���kx�r3s���=5j�1i�i��~�3:�l�o���۴i�ykp���z|$�.чr�� brk�@�'}i�i�i����-�\j _(�d:��c� �b�����%w��s egѯ:�c��i^���x���s�o9��fw�\iץjt;uꬪ����a��� s�[ٛf|i�a�z�k�!z$�1k ��a |�5�~k���2:^y��4� mu�l&���ui3�la�7}��o�2� q2}�0%w�`%����n�� ��i��-�j0�q��inxjn�y-�\�lu�kapgy�ڽ)/�u!m��j;g)��s���z�-"7y�ԩ�f�=���� �[�27?�ԙǩx�g?�ٳ�>���#s*�,�i��o`��a��y�l�f�{��!�*�%tv<�m3��z�����ӧm�:u�g���#���yi�j��n�0u�w��i�����x���l�fdje�ؾ�ro�� v���|�i'��w_}�2n^���m��~��8k"���� s���֞duɨk�����h̆���#t�ns���s�/_~�uw�z�?��o��k�z�̌,�� �����ln�譫�����0�޷�; ��f�/_~�嫯���o���w�z���zpv2?u�o�\cƌ{�n�9l�j"s�����񙋉ur����v�æm�f͚u�駟w�y�?�x�x4��pmbt ��[d���;�[r`���#�����d̔)]�e瘖�i��r������b�3�8�s���_��5�{��0��w2m/�x�ʝx������i���[�e�th�`_g�����i-�w���]z�s�n�� ^y��nu�l��y��8`y�� w��m�o��ief��ȗ��*kk�y��j���<ҁ\�r�w^���}ό��[email protected]���g���tm*xۥ�ؗ�uz�d�j�t��u��r'��j�5ޮ���8��r��դ9��r�e�]�� /x���g��e�tp$���0��i/y5ԉ�gf�"%%��l37��͛7ϟ=���n;��s�q�}�r���x=���13l�"r?��w`ʎy���v�~� ���3[��v��ƍ���g�q��g?����|�:"88qk��2�7m��(�>ݲ���o7��u5��g�o�2�k��tۛo������ϣ�>��@ccõ�^�p�;wj���m�56}c�8�q�ɹ�yឥg��:�n}?�>�zq,�:�� �s"�j-$?�駟��k�;��;�c��ϥ9;v�p��u� ��i�l)0?��.k�w��� ����v�9�u��flm�j�[ o'�mճe˖g�y�� �$�!;��c��� �z�m۶�6h7ٴ��)�\�lc��'�:_z�[��-e�lm�5�fy�� �����������ϝ9��so%�9����?�����/�t�p(hu2�r���ia�nm�lj2g��u�ϭ�47xb�}\;��\2-3i��4��_t |��?���{���{/i���}pp�tq��xԋ���v��m7u��z��i䵒wݶ��p9m �v��6m�ĉ�����]�z�����'�v�m�ׯ��i�z��� ]���y4e�r��c��o�$ex.� jֵ,�׵b#wә��z ��i��z�jrҙ�;�4��}�)s�u��)�1�@0޸f�5�m���a ����5��2~��\u������u<��z�f����ig����)͙4i��7���k��"q'����� ��0nx�b)�w l;'ro-ѫe8yr�nl�qiwꬍ7�q�_��w?�pr�w���guԥ�^�x��l6˫�0k�4b����xьȴwm�lwt�!��w�ֺ�k5���*��`��===w�}�9�s�g(�9��#is�{����}|80o���}� nh��}�u'tyk��%l���:��.7��2)�뒧�v�zrir<��_��뮻���������eދ;�x�gw��ְ�5vͬ�s�ls�t�e�tg��ezq/ �m��� �f�7khs������iӧ�p� �����=�ܓn�#seo`\q��ܰ�u�2]��c��[;b�3w����͝�~ ��k�i��w��sn�馟���$;w�uw2����q&v�m��-��>��x�.�y��ݱ�ص��ps�7�g�6��~ǎ�>�護�j΍r���k/���۵�z�4l�`\�vܻ��6��b.������^˒�np�;&��y�)��u��'�xbƌ�97i�™7oދ/����\�ux!>�w �}s��f]��;�*z;���u�h�ͼ�l�lu���:���=����t�uɺu�^y�իw�:00`��zv7�����&2r톃���zy��)�fv��3}�v���v��nq-lݞ��~ҝw_}���^[�v-�]�f }344�&��`�q͆r���-�\��i�6�k���;e\�n������4'�n ;�4�ć� 6���w߸ivk�e� �x��]ѳ��zj���m�ik`�x�:�t�ʀ�f�===$5��y�7ȱ"�jϟ=ze��:�&]�iál�m���m�w*d��nb�����y� ���5b:��vҝ�7��촷����ї]�v)c�~��v�;kdҩib頷�2�/3kˤ�¡�]�q�v��sf�ue32����g��4u[?dp� q7�ww��ȕ��ds�f��u��3oٍv�l��ow'�(�����s�~ �9��08 �b��r�-����k�\w ^��y*�.�"�׍�-ȝձ}t`��vw#��|��b�k &��#nr�5l��� �(uk�t�f��� h>j��iȹi��q�=��9]��uf��kz(je{\_���n�����놛�1�xd��͗p�g��΢��v>�6���>7ҧҩ��6j��j���n�&s���꠽n��-����r�5�0��70em=6�i䚠�z�gt��ڵ]k��%#�n� ��p�è�4k�n-��]���0�bd������uk���]k����z�)��v�z, ��{8j���k-�s�wg.��v���wɍ�� �<�j jsp��r�hp�zkun����za�\���0� �\�;k�%�}[email protected]�p����[s-ѷ���v�{k���u�j�dt3ގ�x)�����j!,җ�c&�u2ꨞ���)d��� ���aj�{�u���vr �;roj�������~^;�^ ��n�]_�ʷ�?y�v��}�l�x���7 �w3ɼ�n�� ؾ���zxg���dm4oǻ�mss�[k���q�49�k��ԏr׉��z�֯*����~�f����\�má��im��d�_'�dɩq��zkx�" ������㵮y���#� o�ٿ�0��?�t�_%��l���p��q-�����z��}�2^7���m�v��{؁u>v�q��u��0�#a����������w��# � ������ }�u�͘q���\?}s����>v��uώ>�v�d<�ں�1v����ۭ ȫ�l�ί�,�ќzo�u?/}d�_�~ݚ��g�t�r��h��2ڃ1��>��u��e� ��z�\�ͱq�<�>�x��qit�}�\�;��ך\��j�r�ςr�u�>��z3�轧���f-��6x�@�<�%��a�í)�x��m �(�x��0�t�o��%�1�y�c�,�h�/�bw�8�e |��e���(����������~�u}%`#�8��|��⏼���i�qfޑ~e�y��� �ç�䓫\�u.[k������p��2�՗�oy�_��9l�q}q���/����1 w)e�i�����~ ���0�fj���j��}o<�����e�,g�q� ��yݯ�y�yfcsv��m��rݗ�a5d���r^���j�y�k�gy�t'q/[[�h/�r����z��j�o���ao��d�*b*�vhp��uð[�ym ��r v/��by�_u�cyi�ke�r�q�~5����"m��#�8j]١ԯ�ց��ܩ��l�w�"[email protected]*bq=ͱ���~.vz����h��� |��yh �w ��^wqi�/atq�s��|��0k�czd3ߴ�ĵ��� ��s�ɡq�*�u��%�y蓃��#/�#uf���i��mzuj$c= l����&�r�dd��� ҿ�f��ni�6�|�_?���z�҂��� ���x��� / �: ��;�u%ᑑd�g�@�p%���ҵ����g|��!&}���2���j�]��e�ho}oe*��*� b*�q鑊w �*��c��q_t,#w~�n��%�ݞ����$�wn'�l�yn�/��/� \#���ұt|^,^��,��`߂�d���r���0�ƥ���jofm ��bϻ$kat*�9�/º�w( c��;���?�{*pd'�%�a%q�0�������]w:����8��f%v $�&v^b%�l�h8 tx.q_8��fʲ�xe !y�ld����"g �g$��\��|:s.���0�s |o.p漏�e����3��{{�`x>$v鼾����%*�����|��쉡k?���4��hc��>�2/�;� �j��@�xc�)�j�3$�� pf��� ߻/�\��t��my��2�t�]%`m�/��y��"����{xk:z��u��r�p2zb����p1��a!kt5c��u��ie!~��"g�����9%�p�轁�yj��[6���twl*��˕u�9#�r�#�p�i�� �l#�yd.�����dj�rp��fƫ�0*���x��8#�ç~e�vf|l/��t�w�i�p���l7"�a6e g�b o\dmc a)�4 jjű�}�z�x�j ��� �*���p�e��c!\��z�<�;�吓���)2?/ yote����d��1��du���")��"�u �������r`���v2ag�q�.ʟ��q] �t����ɳ�zz9�!��=; x'��_�aҥ��w�`�՗���r��q �b��y�c� �� �"�)�zx.,�6g� � y*ǵ�,�&�"�����#æ�������y�:�}�>>�0�)��d> ՝�e��f����b��y�ֻ��s��bը�t��w��l���fo3 }�s��0 ^g#r�y�q�0�k��k����r�d�]o� �kf �|�#�p��"��gdo"����k�i^��u(4�t� �"�|��ky���\a���؆����9��b|;烼xཌ��{{y��%�j`�n8���lǽ� �|�,{䋳���a��s�mx��,�����˲k���a�� ՝$0t2��l�����y���扬l���;��������kl�u ����z a0���4ud�4�œr�eu�� ȋ� �]e���2z�s�r-8v �c�;��=9"�7s2�'_.wx�ԅ������bf jṅf���,�5����p(���4�z� "�)�^w}ps&��������i�.�u�b��:����'���fva��y�����g٬bed�!��"8a�6 f��h���(��ǭj��p�:#�1 ��")�x�����gin��0�4��ˋ�d�з���_i �6a$����f�r��u�x�o�cwi�ʪv��ǥ��е��g{y��g^��9����h������"�o�� �a� ��6{al\ �|0�i� �}��e�l<4uv%��8��u�bjv:a��sӿ��o�f����jae;�"�\�p��w���j�jz�x��-;/����c�]�}������wub��@�%��a�a 2a0�l, ��� �la���� _��h���}��i����h���*k`�e�w��t� �/�`���5����o��z�o�2��wbvԋ�|���5���x��}l �!v*�>�6q��{,[wvr������\�b�[�o�=*7�qj��)����s�e� u� �8d�ʆ��_ #}o$сe�ta�w����!��kuʀ�28(3э�u��t&�c�v��1����x[{m��,�1o7�ª�� ��j���uo�(jc�� ��0/� (�^��32��h���^�t],��~��-<ȅ������o~$��lad$sl����g��d3l/j�)���e���h��9f-3)'ߝ�i�o^�9���0��=2wd鏨�(f�`hn���tíigd4*s�o/��f;9��yal�u�[n���f�!4,q������h��0qbw�z���x�����7&n����c���^��w�c���� �ӫ$*�\// �m�x%ޮ'����������7gu���|,u���cq t["�� k"��'��l"�in 7����xz`������x*3�3�`cq^g�����w ĺ�ƺ�bݽ���xr8ёo�pj�p�wz�/j�h�$һ���d.�qn^�7��닉��o�z1�.$r�x�k�f��3r���`��l�#ht��t�lj!!�c��7;��:�*t�r,u�_��l,9k�sٸ���h��n&j���(�7d��n��ie �9�ƨ�����3�{�f� �ܘ�����;^���=����o[t�a�~k���e�4���n��[ĵ�a.� ��k�o���ú=����ij4{l�58��ƻs��7og�9q���(��|� w)�l�3[o% �k�t>.zn!�)�ss*k�'��v�� �xj�45�ԝ��v��;��l�k(�=����,���2 _�����ѫ�����,���������۽�=���܌t��������%3�:r�e�י��i�����e�n���z������ut7�^$^5��9�m���%o�[email protected]���d��� ���*6w���9�¬tifwqf�0 u�bo���4c�� ��y~��?� 椃y��yݙ�d����xo�4���xg!�,�� �����>/{�.y���.�@�v������޼o�q��g%�g��φ�i-,����%k�req�4*���xg��d�w��͝��� ��}�?6oi�veɳf2�̓)�x�(����,����2p'�ǽ"/x<��[email protected]��`l� �>����;�bȧ��#�ǒjeáo{cr���$m�9�ns^"u�"f\*�hi��^w���x�77���=gކ¬d����: 3;�1qʤr�4ph0;�p����и�1b���0�m� �x�� "/��5'ks�e�b( ���a�]�u��� ��ul���0,���$����p��l���h�'dg ��dw_"=(�,�ԁ;j��u?��u�ӕ����wv�8lj���t^���h����!��,$t���jf��p��erdm΋ bz\f��j̪4g�;2��²b*�v�d�q�a����:qd*���0;���9�ܱg~��?�o}fk��r)ü (2f���b1h�1ke�z2�[f^���|��\�=��_��6����f�x�`� /�<��,�]�i����ji����k�� mi���4а�y!��6�/��u�uo����fs� b� 6��]��i-��q�h>%  �ί飋��{y��h�-����ژ��]�-~� ������;��o��ar�d��n ������4�s��΁_�����leg��^�s���0l_χ��n�cy�cd�u��,���hs߼n�nr:#�,�a&���� ijg��؜�~"#&�=?�� ��4w5w�m5����u�*���fv�ս ��v`i�v>�bw k�2�r �ia*k���ߒ��^����w>��/�ɓ1�ƚ�\�!-9"��fiy�b�x���4m�* ���; _{!s�s��-{��oh��tock�ė�����qioӳ�ƶ=�m��ω�}m��ڶmx��a��ikwny�7���)�'-�o����4,�ް|s���ƶ�ƥ;�z�6-lz<ܸ$׸$/�� 5q�kw5���,*o|�|³��}na�)��dƿ 7.�6��2ai���|òҥe~�s^ӣ��%�[vol�i�([;q�@ӓ�%�&q�|ck��u��u�i��kb ��qi}��rhzb�l�qq�q�p㒁y&� rihllhj�o\66�a����f隷a�� /6�8tb������]g�o��gw����'�b�.�b^��d�e�a�y�<�����ff�l����g�5-�'6��60&}��j��qe��{�ӫ�հtz�m�v7.�ӹ���ji��غ��ewc ��= dy�׸l��뾆e���w5-��ض��mg�ҝ��[��� mac ����e�',韸tw��ۛvmkxak�2z��'��nj�ԓ���4iqqғ��%���z�p/m/ cos��i ��-o^�oj�v�|��'��v��ۚ�vnn�sbk/��-{&��=0it�l�bck���m�/���f?�nx68�yo"� �ke��_�sr��[�n]��ʔ��i�,�4,�q_=��������z�e',�nx6����#_ts$c���*�c�y̌������/�����7��oͮoowwg {sx��[��s�ÿ������v�6��)x&6l/]�7^�kw���]������^ 6��f�������&t�fts3��fxaӽ�=\�9��s����� ^�_� �� ���� � [�s���� ���w�����ѿ�q7����s�� �3m��>.s~e�}~4�\o��4r�h����b�����_�|e����՝��� �� ��o �����wq�����u�q�w��@j;��������vv}'_e�hv�ød/l_���o�@�_����] ����xe�l ���n�)��� @߂�xh����� ��~_:�f���<��9�� ��>_}����[㕷��7w���7wno� n�8�u`3p�����;�{�� �����]���nl�m�� ��j׷�ҕ7�ko �ƒg!��f���� ��.��m�78�z��� ��xy� �3r4�~x�1�(>:6�hu��1���� ��¯" x�[email protected]c����8��û��wrs������������#�'����������o ����e�c�|qn>β?������5�le�x����������w�������8�ow���'s��c?��ol�l'f��?^��a��=]�iw���p�?[ك la��f��yv^��՛��{��3��7qj���h�v�r·����=��������nk�fv�e\���� [�7�o0jn� ێ�r�]}�[}{t���퓯o}m��9�blܵ�߶�~w� c����׶��v�o�^�p^�d��pnn�7� �x�n�� �l�zoap������߃�px}/z����s 2�=��;}�spւazrzmo�������ō�#>f����z��qc!\w`�����| �������7����;���r~�r2o\/�q��z���� �}qeqeqeqeq�r�wn?ߎ�#�撺k��!kp��gdq���&�m��wch���4�� ���7|r�' ��.i��!q~i���|l#�����m�����4�6�4b�>%w �fi^��[y�!���nh���#�s����v�$�s��ux����f�]��_u�ǥ�9&u�����3�~�/m����5��d�d=%�[xk�1i�d�. *���`�zdԑ���_��gw������� >(s��s�1<�'�s<��ot��l�dy��r�(ge��yl���?��}h�k\� �p�#b��ˆ�q��o��'��8#� i���gd�f�sh�>�n�vl�#"ý=zh�<&jn�����!�yb:g�u��4�����nbng��zj�=s0�[email protected]�yoȝ)y� ��x�3����1�ߋ60$w�6����nć{�&�����(�ᕒ�v�����c��clv����'w>$w~a�>@ö3��>a���7\�muj4|�9�% od���[x�f\/i��o�rb�d���#��ȭ�liqj�_ɉ�e5"z�yf���g�i�1�"��5�(��ys�m�� ��s���|�zu���� ��n�k��=j��3��*��?�=��v���{ʓ�gx�*���tt�����y���qq���� �tpq�9�!����c$%��za`u9q �fd�����z�)�d�8! `����f�!�aj�h�~ û@2>�����`�%�� �[email protected]�w�>1"b��(��a4�y?�@vqzb�m��'��p�e��g�k��=�"���� �j�d�9�8 ���&�ct�����tx8�<��g�� ܿox���p�u�� �]���#�� �n�[email protected]�ʐx��="?$������������a� �iqf88��kvlr��� (�r�?����3�=&��@�@�@�@�ƀ��lf#[email protected]�oh�>1p`�wr�g�b7��/��x��d�����7&�͏��я1֨y�ë���n��v꜔�;%��r�(�i�b�z& �}qeqeqeqeq����w���h�f�ka�|a`�˔�(ۂ�p�a�ml���zt��yfۇ��p�նi=��ca ��gƀ����a�0�fz�ԅ��sh5��_��r<�b;��g�?�ٸ(⼈��ގ�f��� ����ã��m�ޡ���w�" ӿx0-�� 0@��6#zn�6 w��)�&��jti��@m`�@��;ff 0���`�8� � ��� @�j����h��o�zp�si��u����)8)m����vi� �^��tg��b�p�#��b��`z �c#3�`i�c *p�dh���ѯz�j�αul�������h�7�59tw�\a�z�!����c��q�1����y�j�`���eu��g#4��gqܛ� �����a����o~��ow�xpb{q"��1��1f�;0ŝ ]�)�q ���o�(�ҭs�tx��=%�!��|,|jb���f�"�g�'�g� `gr�� }�f;휴 �>c�r�12��2�wc����i�k���q� 1�]hs��u�0{ag�;w; ���a�fx��@-_�9���[r��� ̣lڣ�됝���.�zcq;��'�扠����(ʣkk��ޱ��ucf�h{�t����[���p%ٕ_� �:l �scʐ�f��@됴�]�:���vg�ν`�7�|@����6�����2���<�%�-vaf���>� qçs���~�����~�q�w�qo�#s q���.��ey�ey�ey�ey�eylkq��_� �2d šk�)��,����h�↥wǃu�"f�u��k��au���ݫ ��ftus\3�cfz�:��}�z�zf��l��j!5f��t�;ĥ���"�������v��k�vhz13"q*�wuciidy"63q ��6����:c��x�1����s�q��y��#�3�:̞d�$�"�c����r��)j��254l�suǵ/#�sӫxc%� �m���&���3�����{/ �")�h��&�8��q�����e �i��q^ �b���/���0a��lua6�0��"be� a�\u� ,�ua�������㰞ã�`�ٸdc��� 5]qw%ݙc�ba�1�ԣ"g5yr�,g����ɽ�u,��e㨢���ɥf��,*j �g��o�� ,��&q�0�jˮ�-�/�q�d �-b{��hd��@tsa�v��j�g��l�q[2��v_j �c=�,s��#$#�cԡc���#ڱ��qg�%��f��'�m9�8�w�!v$���c�ў�ѐj����fu�k$i����2����}��7��8k��5����vh� j1�&@�0����v�� �h�<�>k���q���߸�ַ�~�^{�qm�<�3p<<�s<�w�����?-������>��]��� �"�n�p����d�k��������vd��,d>��t�ӫ~*a ��s2���`` ���e0:;|ja3��@�'w�����]o�|i�rx�f}����ϯ'u-�]�n:�� f,hi�jj\�\q�h�5�ۢ�/��de��c����l�k�'�m�5 w�b ��z5��r��ܿ,�j*_������[��!n9`bfd�� t�3�މ�y�w ����0x�����i�3�-x�'齚֫j=�8��c��'�}�>d�.� �' ub��h�ǖf��_��v����5�6�7ն�8�iś�zn�<5t#�w��s���}c������$e��_�qge�a\��2��i6k�|p͑�ͭ}��i�c��xb����x��>fz c��h��i�#�e��?>w#�$ٕ���a��6t5 ��0�ϗtor]iq ʹ��*� 6�js*5#���v_�ק�o�[email protected]|\�nk��r=[��c����t`n�b,��oy�@�g�~r�k��ԍ�s�1�l{���z̔u �&�f״ӫzvu���_u|��c��o7��~o�3��'t�>�fn̜��'�/i��1,��b�ت�/�.�&�b��pi�z��qxտ��1`i���r=�ogɣ�ƙ`�эc�^�<���o7��] ���%9d��� ���p���o�x�0x������<�歅�ym��h�/)nu�^՚car8ĭȃ߾������e��i^�y�n����l8��_/�e���iί�ȣr�qv$<��,�e�_of_�������fd���f����x*2՝ ��{`� �b�: ݐl�d������1��{���i�5b�鑽�pxʈe�ԙ\y�|�������l p<=q=�t�&�ͮ�͗듪 ~��4�ۇ"�����x�� y���k��-����>�������w��]^j�cv-���%w�}�g��x�#�q�2m\0�z��,l��a���r-��c�zs|�>^n����"��dd�yc̏v!k] ~��b� o�x�qx��zs ��@l�:�v.l�ds�c:1�zx��ޗ������a��ei��e��c=���5� u�ٴ�f���,�����[email protected]��~ fvk \��)� � ���]sf5���`"�<��`�� ˟o��fg�eo����5�k�kھ���l]��1�����4mn�܇yʬ#���w.�)ŭ���!�[�8�!.����z�[�o����w_k��}ac�v�d�!� � &�e��3~`m�g��ጵs��0���6d��l3�8e��8��j��&��ê��|x�y|e�-)iq�&v����o���{�q����>�g�f�h�&�#�m\�q ��[��zw�5����:k��j#j �=*e�/i��jw4����̘��mk�n~l�g���0yt0��ѫ�=�<�i����1i�ra�幔� iǧ�o�1�^���j�mh���>ʕ�ʹ�o �fx���pihsfꥨ��u2kf�go}���0������ږ*#it�^yep���nzy9a%/o˼>t����ͽ�d>by���^� 8\k` ��im�^�'�f\�c�v�#���k�!j�zj�1s1�%� �>���זg �eݑ��"���â��̪�pk�* <� �.����=��v���ci�����ym����f�9^q�=�l��3�qd6i���~z�ݥ&�ٵf.�`�wh-զ������e�`i=^���f�� k�ú�t��[email protected]�` `�*`�*����0p%3si�����g���1�"i����s ��xt�sw�����[email protected]�xx��^jl��ye���x��#�yd��upӎ�և�����e����y�ϕv��ɇb ��p����;���t{�����|ȅv,ys=��*�{� /[aj�a�v�� ����v>�8���aq:yo�)xބ����h�"��qz��"ʳ���e��;>�o��q��wj�q���hvֈ\e}j8?���]܋:?�ѣ��-�?�̀v] ��1����37[��ގ��@b;v�g�n�&p&p�l�1��6��ɕ��2�]�vbz)1q �*�r3�\�\]_jl*j�0�� 淳�@�bi�u���<�j����m���f%�~k�����n�]�=��-7b�p4�u؆ͺ#�1�t[�f�f��k�`� z��ϼt�p u&x��h(�: ��-t�s��d����p��"�� ��j�p�����4g=���c!ʤ:� ӧ�έ��_s��:�������l��!�� �qe�_�����@4n�. w�0�j��t ��c���c�8�oeo�o�of����@$5�z�����z)�ʫ��4"ao��m�xd-�r��}�c$���� ��>%-���� n=�́�7|�":5���k;�k�s��i��j��j��<5w��u�8=�0�{�m��gp�] (�f�|�(�k�s���:��c������������s�uy� 3�p���5��%k� �!&k��{�����2��p� \�w�f�����â� ��޾(��(��(��(��(�w�����w�#�ؘ:hz�rs#��r�#i �$q9f� .�,�ba�1gr /)��w�h�� wy�����>a5�}c��d�=�h9r�,o0�4����q|�<��i%�%u �k�]s��e�}j�ը�g0a��>��գ������<�����_.v>ԇ.:2�jh�v"z1s|ҵ �wٌ�n'5 ���������;u��y&-q�'��٘��o��5r��3\:���n��`�,��ir��"��s\kge��a�� b�0�� 0��t.�v?mt��04! ���[email protected]��nl��8b�'�oek ��d��3�%[email protected]�3jq}�h��[email protected]�{����r9=�����ԕ���6����[q�؞j�k���cڨ�y(��x �i*xa�t�!�c��k�h����6���6��i/7����肶}�q��iˁ�ts�v��!�����ъx�|l�g���ubq�"� ������]%��{�%�׀���p�����[�#�@�dpa�>��_tu @u�$5r��y%��m��收���ͼ|�/����.���ytn�,�a�;����;�b��,o�l\�st�poͽ�ɨ-�4cl]6��oto,i��d %��tm�\x��q��i� �bԍ��q(����s��ε14������ �g�:fxgx��yd~���r ��úun��虻ɳ�f��na��6t�t� \��t ��@�b�)t.���z;`{�a�0a°5�c<0ߕ�c�h�j��)epy�4 e��l�z��������`�j��,'`�9u0������y� �{o,�u�{��m�#y3f�?,� 1|��a�!$�0v�ǘ|�b#�˳��^eƾdfe-o�cc/v/6�o��wu�ƒ���q9�f�v��4f\�^kyt�]/�q�9����p\�pq���9&�a��2���s�����vqk�ؐ�ĸk7s�zh�\b�{d����<����s���z�g�r� ?���\���b,���yyp�̭e-ky�zֲ����ѓ���q�ŝ َd3�/be�t� &p�� ����c��v���7�}�6�9�ܱ8s�ɏis y��vu�;8s�,��#�� '�у�f\ӂ�>�!�� ��ó3�9���ot��v�եǹt4��`r�ydiw��.h�d�@��%m^֣�u�:�u�p�o�5�� h!w�a��,�i���q�> �g��!�#:�!����0�l�7wŝ�ىkn�:h�86g������%������d)7�ec"�����=�=)���v�qe���t1�� >:b�ϝq?��%k.%��\.y������!ӗ�tָ�2̗7���4'� vc�����\ҹ���m"�5r��f#�5br����ΐ�)]q���=fҩ3d�ld�#�׸("���m�g���n��� ��&c����@5ò>�hӊ6q�;5  l6���쓪u�j=(y}� t�gԛoo$�c�9�z=� �?,���![!"�z*3�(�h������l��q��y��w l*�{��9��}�lod}�h�܈$#�� �be�� ����� ��r�%�rγ�� �䇺�=�ˈ'��<� ƚ����lu�/���{a�3���t#ya�e���"�j\�����cp�e;f� t��j��5��m���6���zr���b�a��v3d��m !�(֨�e�x�w����jf��'� x��$v�dᒒ��ek�b�?�v���[�l��}��]b�9�r��ck1nc�d����w�\22ak*��k(�*2�*�nn �cmv��ɋep3?f�=���� �ߥ�.k�`��� �ԛ3 e�lrb�i�htee�\���'ht��1~,^���`�|(x#�_��ump�ò�,e;�e�x� ف�7��x�������t&���| �_"�u��orx-�zd؜���x^�3>�98q��gߙ֚g�� �~�g�p���;"l�3�:f�c�[email protected]�����o���i�ǧ���}��'�9��ȹ ��3ve�kdeִq�k�.�p�zִ�s/͟����z���vn��1muis b}�^k�u���*���d, �t\dl61�x\f?���h�����sx w��ӣ����kư�%��a��*�h5 �$u--��r�(k\�� �ߜb�[1q��p�i(,.�?�-daeo6�-j�)"��q �pa/���� ��x�b��bo�º�١�,��f��.��Ꟑ&� �fl�7�k3�h-y��=);�{$� �{�l����;o���)�חglj���9������6w� �} ��e-ky�zֲ����ئ�t�~�5#w#ikjƥ�'���f%�k/f�x�b��;}$�z�����t_ʐrᙨ"� ���k!mi�3�bf�i:f�ދt;�l��om�*z_���erb�l����笕�n�z����/����g�zovg�qz#(�u�/�1�� y�u ��b�v�;�d�! ˚r{i,�r�(*�t�u�~�:)ۇ�sg��\�h�t���@�>>�?'�6q�xve�t���dr�h���=���{����!���9$%y�\��_f�5�����n�����[����d�t��be}"#�r*�s՘���f}zkl��m��0�nȵ3��7u��v#�\�4h�h9s�����r��v��c����;*[�u}pf>g�w ���,i���p�\����ʘ5��@�ce� �b�s�,�w�ff�e�yn�w-���j���q��p��}�?$��]�p 1�!�u�p�ӧ�!��r�=��i�k�;�"خqf���=� �]�/6/�tu�;:�����5��j�w���ӊ�f��7'�~a�]��s�t�'в�jemvnd%dgxs�hwdz{ux�^?�1z%�"�x��iʐfh�ԟ��\�����l����ξp��o��~�� [g.ڌq��`�_�����b��ee2�aȣ �|��i���eʳe1)�z�umn��*/� ��y�'��`|�`��h&�zr���fz�ѕ���}pq��4߹�߹\�_�ǘ���6v �8l*�fě��b�קnoշ�z��oԃ�6����/#�؋��i�9�ɟ}�`�u���j�[$�>v �x ;w�o�`u�$f&�ek� �� h�/�iğ3'��kz.kz�����5`�`�^d�s8�9�!� �<����n�q��]٪]��� �9#����� p�?��}el��g0���>�� c���f�����}�> �gu㬦�7������8bm.9,^��v_<��/��^9�$�c��q�@�����ˇx{2�ɠ8-Œ��9�i��;�j�c�ek�-�\¦��a���}b:��s��g�ax�4��b��ʈu��z�λ�{$x�q�5���z�j ��v���h�%���/i���y�� �����wf�o���� �����a�<qϩ�@���d�`-�ck .f�:2��1*<ц�r�{6s �{%�_շڠl�elx鋶��b�*���=�^� � p�,doa[����w��l �n�ۿ&uorê6��r�ymq�`�����{�z^�s�8��b�x�}������8��zmf����j �����5����z�9)[q�tsx���#�������v���#�'�q-d*�_,8�9���(����t��un-ky�zֲ���e-ky���x��!� h�7�_�� ��ԏ�5�vf�o['�}d�=�j*���x��c��͈�1�"�dh�s�;b�#�����irªoփ m\2c�������w��} ;�k�����ӫ�w������!���s�h!y 3ӂc�z y}� ���]�v�x˪>��š��q�zp�% 6�rp�r2g�9�0 u��!�.[c�����lw�� �v�ĕ7����9���<�����/��n����~������ �"d�_� �юb��-��jqwu�(�o_gi�jnafk�a��r�y�����!��wi�d��#�(�.��1f���k嬹d~f�%u2j�0��%3�ͩl,u-c�q�n)� $�8����l�si/�=����c�۷���a������nh� 1�d�����.z��x{��'�;��=�z�y!#�u.#�ll��q �r��&���,�����)�g�}�}u%d�/��3d�s$�{�dvg�=ogv"�� t�b,���/�v�k,4��x;1sj���t��d�tc,k�r��b�����������`"�v��ۧ�h8�� �$�ۗ�2_l�4擤�̊����� �^����,��9#ߙ��y �x!���oog ��u��v� ��u�� �x���j���au t����{"�(d� ��=�u�qmk�ztf��/c3fe�s$z�!c<�o�.q�${�z� o����ysw� =e74kcf,ac`�[email protected] vy#7��md/�����[email protected]��p6�=e� �€n~���sfg�c�bc�n ���}��c�֜�~<�.���u�����gߨ���4�옸� o��3вuv6�e�_6��� ��qc.멢�[wn�ҕ��� w����yk��ʏ��s���9�e<�|�g�� �k��y�a�]�|�z���*vt�f�����9�.v)�� x�&] ��s�g���v�!8uu��*7#m.7���3/m��nt�1���^�vnzj�z�� ���b�m&��u����v\�d���5��hf�fji�i'�-؀�������� !”��lg}v�g u���fw��`c .�鹑����quk7_.��.���;�e�}��^�ze�v ��l��0c�]��%}�u _����]�|�λ���z*n�p�3`�6� �u���� ?^���\ ܢ��e�;����k�}-ky�zֲ���e-���;l�=!��ca<�/@��9 ����ʋ �>d=}�9���խü�=)�yi�dhϝx �֌x �ͱ� div��%s*ksh�d ��xrc憲��qe�t�iř��h62ds>�t�7��6g�}����-���~��#ř2�&ԉ�r{$��1f'��t1f%mv��hֆ�r6c�l$#�ff���f%�=�4�ǵɒ~r�ok�l���)�!ݛ�v���ucو� /w�e#��hb�*v���:����~x;�j�3�܀�1s#��>~��/�o^9�o_"��i*��)_!�e� g]�/�^�w�o|������w����a�����6ò>`{"��% ���np��ɉ�s{q�қ1.�{�z�dvu�t��t=v�r}y�s�1��6�%��x�j�uq�rc��sⱦs([g��[email protected]�d��?g^ ��lt��`e`e� c��rk$��nl��)�rj͙5�|�b:�#�ee xl{��=�轲;t[�܊ц �(|f{ 3 sl�x��(99#*���?";��}�zg�)z�j\12��#ٌt=q50¬��>�[email protected]���w�q7�=�ܞ�=(����3���pm�t-q�ֳp� ޗ�1i�ǹ(!��`k d��q:1����%sň��q?� ~l�,2$f�8sɛ��b��[email protected]��v ���ꝧ_x� ��쇓�ȇq� \���_��b|y�l���y:�gy1ɋ ��߾\�����/{y9�tx��¬���z���@78t��olk"��༡ sl�ƨb���b�'��#*e�ćy� �gw��ʼn ܕ�p�ن�2'�n,yc���#0�!����� �#�f��x��l$��q �!1bf��s0zu,�.`:w���e��c�.�y`o�8,x�1��.\r6ò��h��`� l�a�l!�3ق�nj�z�xiٝ�0x눙w�{��'��u�4~���ԛ�s��cs ��;�tq�١�i0-�.��f���ix��biob��v[��*&�b��ӕ�2�|e {�����t���l.��{e�,�8 ��(f9�d|��y?&�8=��� �~j �t��'g ~��e�" ��p�z�0�pn��}�ky&��lc{b�3��%=g�l� fµg%{t� xv��f�=�h��5x�f5s �~�3�;=���~i���%mzղjczw�r� �'`t����/��u��u�o��d�߉���j������u�ކ� cxg vxc����ekrk�7���sev�c�^��g�ƈ�� !�x{���u�v�.��sř��"m>`�tidjc����a'�sz5�a�k�i���q���\521���&��l�-���>ev( �c�������>��kk�-]��sd�`�o�a�.x>g] �}&���%�e|�a��ֹ�zֲ���e-ky�z5)��g���i}@ dv�eh,!02sͨz�=�x���r�d޹o��ӄ3�����t89(����������r�ja� �o���:œm�i� p� ;s���� �_����d� -^k���t�ѝھoz�h�4ψ&�$���1ٛ�%��pz4'9x���h�$;)iyk$w�``� r��k`�b�gf������{�q����ò���\�7���%��h{�<���k���"� ��r�wp�|��cqn��pn�%���k�?!z���?�������v�u2�u�ӕ|�m�2g�}��9y� ~���� �5�f#� �i݈3�c��!7�gط�a�ۚ��49��s���, ~�6g՝ps?��j{������� &��ӝ���m����o��f���l���v�"���}�a�oū;�m0���� s�qza���d焴���݊q��ݭy�s*�k��sin��ƌtbd0vr��v�𱫽ǯ�/���ֈkz����sv0�wg����\v�lr�uk� s���e�{��}|w?�z��a�k�9�ɣ�3 f.�=%������m/��t/���ƈ�2���ہ�3p���ka�o4���y�h��]p{��q�1�h����p̎�({!� �d��`��>*"��l����%~�x�htc8ɍ\�v�3;:$0���y�ʏ�r���q@�y.�yq,d%�,3�d�eʋ��h�ٲ�ӣ���3�����m������ s������i���;b |gj���8e!7s��naw8�,���ݘ��!�>d�� ���1a�.�ò!��ƙ���[email protected]��� �@���_1:�ޘ�a�r��!֤l��c�t�j/i�`��� ���梄� pŋ��ɖ�~�>r�!����ѽ�5 ��f#g-n� zs���!�u�wm�7ӳ��;n�lo&��9�]�^)��1����ȍx6'%7��!1�q��9��� {��uh�3b&ԅ.a��js��i����"���bzv���r�-��ķ"ިo�'�j�c��z�����8dp��}��w��?��7~��x:��m� _a^��jwж@��\񰜌'��ޞv�=�q"���h�j�0mω�`x��: �� ^>5�����c*fxђ��m8����%��=n_��������)�1����?�t�-k�i�%cĭs�w���l`q��5(�z}p��ٓ/�ͻ\\vs�`[email protected]�}��b�tk8�k���&$'��敝�%wr�ig3fs��h��*�1�� kg����������yn4�m/�a!����k�� �����o��$cn� ��0��#�ttw a�aă�$�o�l�{,5�nj�*&yc�$��;�����@�����\2 �*/_��p &� ���jj��2շ�^�jx0���"��t%���?��o�f�]����?�s�? �ȋe�p|��)��d ����e-ky�zֲ���������~�x���sd�̈�bn=�mw�4n>�u�9-�)7���[email protected]:���mn!1�ӌ��`;���js��\<��o��%�o9|����rٟi�sr��[���:�;|c���]�:!i�c��}���i�z�uj�c���r���x ���m�^�䖸�m��h�x5�u}\���-n~�y <�]�!�׹r���,�c�n4�zk�� }�žy }�u�oo���&�z��٫igꟼ��mkzƣ�pطz�y8�#|������'��y��v'��ra�?��e��me{��s�z���_�������)�k���z������[da��!��.w�e�q�jd�j��7q�5t?ן� k�� t�%���b�4��z����'y ��c�c��q���swd�d���w}?�kl�&�(�� ��`e^^#������ lf�:�p�-zd��ة_dl��5��&k��b���hi��b҆qv��cl f[ �, ��=�fȳ��l ������2�a��t3g�2� ���z��c�>d���vo?��,}� ��m(�s��onv�[l|�����p��^s���]ޮu��5 ���;c���ǒ;/����p�?���w��#h�!�����ӓ}��n�z;���#��.-�l��jd�]ǣ��:.��/���`# ���{,5cu �4�i�� 5-e%��e%�r�.���(�`�_��ľ �c_i��r�[�b�[-b[y�g��fdӏh�k�f�if9?�9��vm�suj�bj��ă ](�ϰ �a�ѕm����:o6a�x��ir�xp�k��e�nn�7�~������qx ��_��o]�v_6���k���ź�v�x[�f��0��,(�6��qڊr&�[�c)��]��/9>�*�a�1�=�;��\e��z��}��v�8�q[�q o)�� ��\�� ١�dew��c��a�i"�&���{�&�2 ikm��̝��b��*��2�����&��a�v������f��^^��\s �y�<�j��r �5p����s�. �֊�ȣ��u)c���`�#��}�&yy��u �]�ƿ'��wa�ux�.��(�\ҭp� vd�*v7���'?ch��b�ۨa׳�r��*z�[email protected]��n�n7 �� �øs�g�>h{�dw9�*,(վ�\��z�v�/5j w�(m�� h��7{�7��d陟�� �a�ۄ�����բ��fk�ƿ]u����=��8�t}�o���mk���������v?���?���?�r�'����s�v&�eg�j `-�.��z�x)�s{~2b5� _��cw�a ���5 �2s�����%`�|0�ed�hl�d��y�`x6 � g���px2r��] ����������bj��$euc�[�5vl������tz�k�w���h�r$k1�<��� j��؏)|��p5�c߁�`�*��,0t:�� 2|22���e s'�|n��(�zq�#�mf����"#g�g�!��c6w"�&��u��c,���x����2����ɵ#4��b�'�"�&:[q�q�w����>�����3��>���l<���o�����_��z>�t��f;��1}���g۽�n dl�����ࣀ�k(�\���e��m,������������f��`�<0j9��\ �f�����5hގ�%&mds?�_l e]�j���a%uhi��ԋ�&)cw�e��6v��� � ��l ����a#������7$���d��~(����s�˨�e�7�!���ȸu`�n���);�mj�&�w�8�"r8dj���cl��9�\y�;����e���dm÷a3 ����ѫ�k m�j�i�uf��fr�k �u��sq�o�n^��������� �途jl�l���["�w�e_��<'�݂ ��灌%`�����k�>�)��jz���s&bepmu�s����"f�pƃ�m��4���7k��"�ˌ�mo�i�,���l�w���z{�z;,�]xu�'?u�|:��[��m\�,�ˎ�|��n󖁞�]8��۹���o6����g�=�bp�b�9��6����qs��ڸ(���ڌv�#��i����!ȝ�d�e3���`�0r9�e��`�b0:lyfm�v��s�w�����.��q�� s׊�kc��e��� `�8fƙ}|n��ս�7й��r�$9��m(َ��&p��;=�*��.�fl ��/e;u���b(#��q� )�@�kb�ī�h<� �}j�� [� g��;���{ilg����=7c �ed=,k�:=����g ���� i��1we��y��ې�w� �8q���23qn�&���hl(�n<�s����]�܃�[t��?�k1�y �x��j��l���jm ���k������w�1�1��b(;d%n�ԉ��!ղ��53b�t�ΰ4r���[x��6�d���v�ky�޹l���ӫ�wtx\�sr����s��)o�� ��$0��չ�]��t�ndy=o��,�����a�0���q�bh�r�7qۿ՜�6�lz�[t�q�e��\$c&1������7�%p�b~�4t!�^�� ��u��㨽���?đ5!t��4 j ��n��a�v�ɯju��&j� {� ��)[z,���� �s-��'�ɓ��e �ލ �[\*��:e �:�h_��� �9�m#;�p�����*q61��tu�"6*��v���`�|0j6m[�������w�v ����a�dn;�տ'�q˶�af�aæa���/��p�j";_���xq-ե��tk&��@�~rѵ��y��^�/��.��*vhgu\㮿 ׶����*�ūg"�[email protected]�p�����e��ʳqp�טc�gho� f��w��v����db�7u���m#|���v��>d9�ٜ~��~��5��� �t>�l�5�5�ipv-�~ "�u���\4xdp줸� �3�h�\��1/�s��"f��: )k|�ȗ�2�'�%�c<`�ry�gb� ���o�$axx\hjz����g�j�x!��������d����mɯ'��iv�y�yms��iڷ16';h�dq�ia�gu2 5sn��ܔa9!�/��cbs�{��3a�ft�.�6�n|�|w℉ii����a}�bߌy��[1if?� %5�w?�3e>�7.!qѣ�&�bw^�e��q��  �[email protected]��;bd3n�x!te�sq����6�ԏ��j�ha�)la�%�6yu���^��%n��m���������{���;=܇l>�]w-*� p����ocoo~l��@���rh�� �p��ʦe�ty#)��)���m(��siu��7b7�l_>j�,�7��b�4(�sl�gc��&���4|fҳ/d�ʒ��d�g2ⓦt{~g��˒"�x�!"�36�ikpi[��$c��lm�2���a@������%[n���je�}bwgr�<|����c�:����g�o��$z��r�.m�7^��]�9,�.���%�_�|vxv��^�!zeg̈i3ul�����vɻm�{�z�b�{��� �v�9y釈�����u�j/t�q� �&p�ʬ��*�@y(���:�kq�����i�'�݀p���l_����ۭ���{{�wo����_�\���d3�������6���n���x<�h���qt����2�c�� ]�#������u���z�n� �����g���c���a����/�j�� ���fv��34a�k��m�{�夬�qc&�x��>�� l�д�1[n�{�9�j8_��ݑ��r5����bg���r\������]_0}�=�!%��c�z� �=�}ܞs]g͌��@:��ظ>c�n�z�r��a����k[@� )w�����x~"�gb�3�q��"�_1ea��e�y��� �]3�\��7���q�� �d�?�?3wy�:��\lm��a-�� /��'u��誅�0�!�lmʾ�#�>�z&y�,ej����~q|匳\���fpq.�� �a�]t��^��i�5�g����׵ b� u���))q k�x�u�aj;��`*3jz8"���&���[��8� � ؙ�񧾝��� �#����[;�7����z�w�w<<���������p�&�u�h�������=�k��:x^�hj0���q�m=w�~��qk��&ay��� ��¦�d�� �����& �<>xl�щi��3�2�c���6j��s��[>xj�ܽ�;/f�� u�$l �i�vp�ly�����`lo$�w\��� 4�� a��i^�&�ݨ�#r���_���l�ld��^�='v��j�~�1=^ �<6t�b��k�s���zī!���#�1y����4)2典��g�3e~\���ˤ#r�疁��`��<�uc�x��ijw��4& !���xr @t\ʒ.�χր�vp� /���e��m����s g-~���^���bzf�f$>�*tv� �t�v���s���� f�� d�#s���w���%�v8um�ae�ͫc��#�rq40\֥��ŝޢ���(�,`�ٌ*�@q,�ct3���#[email protected]��f}���yj�v\i���rk��|�6����맫x-��ot<�'��=v�.^�����8\��p���ђ�����ow۠� �� �m���rɖp�r��c����&��^���hu�j�� �&��=���5i�>ny�%r�$<,i$ o�3���7�/�3x��cv��x��׊�sr���ahz�`pp�����ۂ�x�*q�������@v/v�*�t �2��/i���8&�>�f���[�z9����{����)�d]%���1ea���z� ��x��;c�r����i��� �r�� � (s |xl0����ѱ� �rg�y�^�%���<.o_#l}=f��.��x� �6��b�v����)bf�%'��z��lbv��c���z7,k��� \��^ď�g���|fh�r�s7 �����nfe��od� �p[vlc5���s5�t�ǵ�#���v����-�� � ��^v u�|;��j���̈́�,|bi�s����vc��_�ۛ�z�#x�ktᵜ��λl�_��ӫ����-���1���-���������t�'�.�/r�8=���b.��h�@��t��?o�;ɂ��(e�����bգ�t�����y�<`$ ��tz�}˞~�3���&�@dp��q���bo��^rp�҃i vt��zp�t"8e6�h�#�{x��7�g�bm ����1�ܖ )� y�k�9j��$"����y}��v;l;푞��g]�9'v�p��3�v,o�&��)b���ٛ�-��ټ}���m�$n���=���gzb�d����hư�'m��=�ǥu��nkoں�i ߖ���w ҳ�b r��=�ɣ.�xjw��f����!}��͑ǒ;��)���p5�l,o���%a�%v)���bb��[�ј,|�q�r��z;rifʫ��ob�u9ycfݓ)����㇬�ƞ6��z;�m�in�d��̝��wr47� f^o��l\|�q��i8_���~b���#����~��~��~���xo/�� �,�i�@��b��#bz0��o�/{��4��4b���k���5t�����v��ca}ƅ� �<1��^u���kec�v�ڄ��s�! � ۯiq��pp-=o�'6cz��vu}߭�q�n�oi�ek����@2 \��luc��ߣ������l�ր�e�n��g���zk>�܉?���b0}�3t�"���j�_��n�/i���~��g��\4� e�c3{����ʌsw�*���hou~���x�9p��7c��i:|-�4:�mex(5���yqɔ��c��#�,�k�3�z��r9 �m3ʚ0�[email protected] �ն�>��^p�p��=���?�������q�ğ�������4�s�7��_ō�i�>%�i�dij� cl;p��i#���t=n7�l-�� i��4��kø���wbtwd�� �'���<�ʹ}e=��)k�\^�r~?i����e��|a� �wb'j�o���ǒ�ʎw�j�["4u�g˥{v�ח��^�(��asw3�!�7���k޽pd��zbɦ�k��~�m�i���ɋ�|�c7�:�����>��e�`��7[email protected]�|��h4�� ّc��<�g�0mf��f�,m�s u_x[��2d6���pi>q�թ���-��a�t�v �:7�_<"�:{�\�~���#��e�fgze?ku_�n�uk���h�w�'�3��g�t�{ꪓ�� ^��26�o!9��%�a��~m pz�ʂ�e�z��^h6 �:pvu�(�$$�b�i�2c�h��#� s��� wلj���l��uo{t ��8��s��8�m�ܷ� ��a�s��rilm���y#�p�^��dy"�[ݞ6��ϫ}�u��'�g���z��i�{��u�ak��j����:i�߃��#d���$c�a�m��_s ��s��[�c���c�zm���:�����o���v�mҧs!#r��n z >���*��{t��2$�ѽ*t�b��iġ� zpx��,:w�g�lf�툦u�� �w����2�i�~�c&�/:��;��c�o$���d���˱�y�����nih;դ���pe-z�h�q��܀^]�p)�=���(td��mg�v��`l3ʘ m�x�d� ,��ق [��s^m~�@�}wêkť]h��t j�r7�q�����cmf� ���ux�-[&�7���q�8�c �/q��4c���!ӄ0z�n��ofx�4��2�"ӊ0v�6#�#���'��}z뒵��� �q����g���/z{s�kӭ�u-p���]�6qŏs6��,���d�f�����m�l��w8���a��]ٛ�w���ɓ{�n#���&��7��']ݍ|؅��l��x��lg>�^ z���d� �[������]�z��s�v��n�l �]�,� f,'���c�v_u�ӱ�$�f�je�v��@ <��w�g��l�@隃q��zv臨xt=g ��ƿ������5��$�߇����<~�mߐ��t�v��>l�3tu��/�k� ���~3�r%qh�5n�j�h;��~)�t�lkc�]hy���~���a���d��r���`�s�r7p��2(� #�ԣt��y$���� ��z�6��=]b~���]�-|���sw��zv�l0�{7�n�����ug����q��;v�������pr[z����s��ɜ~��~��9p��궤r;(�@� ��o��ž[email protected]��~�}���$!�@ �td���]a�"^d,(�ae������ ��p�ԙ9mj: *�"�f�ҧ�z�9������z�����_�k�ə���}~����[��d\x�eh&$&�?�ʿ����u�hͷ��2�]m�j�cu��썍�i����积٭���f3������os/m����ͭ���c穳�v�ܖ ��4[@mk�v{1��'�̄f< 2����1oyn�.g�_߂�zl���w͒z�� &�·t\��t)�vfk=�04�>f�����cǯ�yŗ��)����?���h6|�o{f�x��릏��n� �������v���=�����06�q���-�4� r�/�)�x?`|�0s7�0>i ���!@�h���$6 i���k�ldq�&'v}9}��{��[/�6�� �$���d�ů���\%m �b�ms?b=�szt�. ��f> jlz��|ƅ�d�k��f09���m�o��m����8㣌!9pzz���u���;���s���r�m9�� [email protected](j;����,�ߟ�n�|����[��&m��a6ݼ����dd���ڣ�;7���86c��p�҆��y��'7~�6�dn:e�rc�2yl� {�^xj�r�?c6����ccv�ry����x��1��o���b�́�8x*���җc�k_�">�>��a��7�/�w���%ܥlk��pf�f��i0�a8{��{t/��$���� 1gu[k{�xw�_��j���cs$ޮ�����ks�τ[��1�d�_�?>��]t8k?|�5��=�j�)j�m^ny|_^�24�l��tt�1"3����ya_f�`; �p�u��*bj��d=���hqkp� "&��a�e�끼s�k���(�2 a?�-;��� ������m?ϊ;y� �jol�ew�%�p �����e%o<��߂x�tq2�6ohn�l- %�� ��[email protected]��>�ѵs���������' �� f���d�g_�xtͽo��ʙ��5���&��q[�j�'���x|�&���m�@̞���a����2p���ey�op��� }|tvq9��ȱ�ik.g�n��\_0�um� x`%z}v�c�cx#ж��>�� վ���os���ߕ���9�fm<�cд�lq�%�j �����5�������sz�2:���z�\k0��p�g�u��c��qkz<��p�� ��l1` #>"a=�[��x���'ݮ�� ����'�t�r:�#�8�x¸9�[b�ɏ���r��xj ��xzѵ�kvȫhs�q�!���d�8i��ld�y���n��q:f8f�?�p�o���ta�'j��@�d���z1s;[email protected];2� ��kùv�u��`\ �m��c>�_.�����}��s���� ���h! ���br���zٞ����� j�vp�!�^�� 7x��ƫigh:fcj}h����all[&��e0ڏ��i'�-9�s�w5���4��ͱ��hn�nù\�ٝw��*s��ң��"���-h�dس����;�j��>�^�q ws1��:hn�`�m��a��� {����͇(�e -hp{ k0q�}�y3v����a�,w�y��� �����z�m|�|0q91���x�@cc�w��nj����������p��,�'���n�n{��|h�{zl�v�(.f�~�s��.�9,~e�w����s�u{�sr�i|���g����<�ɵ���>��ap�6�-{������ �=�л���5�)�n���&/0� ��ln�g,\����w��j�b��d�4�h �|;v}���o&��ns6 �,!*��h"i&�b�/$��u�.�bq!kjk��_"r�uy�uy�uy�uy�u��˒ia�h�=*}�dl���a���b��y'�/�gx�y~fahs3>%�f|3�� ~�on#�`e�d�/d����q�(ְ���sq$}۷�g��v1?��~��<��>�h�9�7c�.�j"��}u|�9�|�|���%ڇ��~�n��k�o�����{/1�i�&����[email protected];� �'���dm�kj�wo��=!��d<��h���sho�v�m'dv�j݇� 3�v���ܕ7�=��~���q,^�>v^�� �^(օ�h��-/�}�#s�d�w���� �)���5&� ���s �ߋm�-v7�u��6x��hq�%����0�ܜ���>����߯n����b� �m��x��)=�����vv/_#7a��d�i� ���e��z�� �i���n1/�&��t��� ����2l� u�}y�����^ծvh�c��[|��jc��zz��{l]��ؓt��20�8�ޏ�4���7���n���2f��� �-t��������a_ ����# 6 b��ux��ςg�o��e����� z��lq`i���r�{��[ �,�o��"�^�x� ؊�7�ƍ='�|0j��1���"�&��|�xq�m� >v,>�x�=&:v��1`q���n���2�[�d3t(��m�>*v���j�i��hw��b��`�rŕ���iԑ�{��f��hvm|感]&7��~�3w>�m�;������q�[email protected]�@�*c��x^ɜ��'��$����fm��[y\]�1nh��v`���g��il�j��s!�)�&�)�����y��|x����'g՟np��!$m o���#���niiw" �`r��nap io���8{\b���f�pq:vb��272�0�zy�[!�� mx�/�"��֟p�grkz�c�׃�����۔��je�80�� � a���贝o��|���7e�~�����]�t�����Ԯӹ������`k!j.囿�ni���q�a���}�� ����s��꺣�w�u��"�y �0^{���otf~r���9i�1�թ��~�/~��u`���i_��lpc���ua}{�f1scނ�����h������"��`�vk��c ����&jcb^�ptƨ�%�ڊfi���u�x���_�c�h �������dw��褲:�.�傼*nc��[��֞s�j�o�.���ѷ�|u߻��u}'���bh� g�ƿ'���f'�u�h��w5����p�x�{sl����/i�<4w� b ��_�b �����;��? � �����ٜ�_�� ����ޓ��r���* �5���듾�.���&0a����:����wld ւ7��2}@f��6'�ߍ�_� 亼������?����/j�@6xd� ��� ��8������f���t��/|�)�-�`ĝpq-�[email protected]:�đnm�^)�j�b��;> �vc�ذ�~��)l������ژ��m_n�?����ug*�]�!�h�hz4)��)�x�� �{f�=����/؄�_b5^"kγ���(w�s �h�|���:'�ݕ��sq����؜��~�� ��i�g>n��plb�f���{�~���-�l�" ������w���(�/�7yp�)��iufl[�v2�ly�b�bj[���4�r g����p���7��b/(l>ȼ�j�s��į�v6�>�5���-�[c����)�����-���͉���4;��δ{�������w��x�1� ���$�v<���'����ͮv��v�ض���lae���5m�uu���\6�aܘ&����a�� �j���,_��x�v�p,_�z�#f�o&v}��6��'�i�ɓ1�nh�a��`�bj��=q����y���ܒi�h�e�|����5[�����c��8u���8c���ф�@�{�kϩ���k�mδ��x��?��c��c;nb��� pj6݄�9����v��3�ԃ�9v�à�ӹ�ҡ�/*�?gڿ�i۝�a�챧� �> �����,����;g}`�sߔ����� �u{dէ伃�8��l�ѫ0�i�� �f>l����_vw{3ʣo�}�;aї�>�:���g%� �e� �o��ŀ���a*�nj�ݓlz:y{(�n{����a��%����_y{��x�.������b��}���%^�d����~��� =��ac��4!���}x�)m�=m�c��԰� 9��6a6e���5m��4^�t d��,��v`i��.���y��±����������c�%�8��v8�φ-ۆ=���)y���o.pl�� c�]����wւ�@�� s�u��ʩa=���!��*�b�����wl�~t�^hm>�(��)�5� >a������o�o�ʄ�*nu�^a\�>`��e�\r5�q����a��l-����گ�w�)��bsv$twy;�ك������ށy.c�k�v�.ak �[email protected]��1n � ��a���������/y�'���-�*��� �_n�s�ng1:j�2cd�k2q&�`r���cc8� �-�t���;�f�[��g�=>bp�9��{�l�`<�øښ��3x��}wl�i�cy��#]�~�|�^��^�1��cd��4��̧���x�>�"v������i�ү)�`o����i� ov���3i|�h�m��#k��nj��/��̓���_�f�����\�j&���h̟@�ۨ�k�f���ؚ[饌%�ϫq�2�����- �~ ��rz���b\jlƕ6���f��b����ܭć�ю�2�c����v���mp���qx�5ax�v[����<���'�q,\x�� -�|i��x��l !q������tk!��w�q`r͑�6�ya� �6�er�=��0�������k�s\o�.�.�.�.�߭������/���`}jڧև(cp*��f�8�!,�-`�e`=_^� �_�sd�{��؇1q`o�t7v(�v��e�<�� :��zt�u��sҗ~�3.�)��e4��=��b����v zm�`0����d��s�'�f%�xz攭ׯ=s��|��c�y��ks})y�sbu-x���ud��"\� � ����l!�� n۪��k���a�*0`��<��z4e5��=_���g-�r��db�f{�ыq^��b�1ȸ1v<��[email protected]�ħh�q#���/�wu�ԍ���ea���j�,=r/{h[s�%)�h^%�b<&m��ť�x<�b�rx� ���c�[�խb�����k��7� �s�wȍd [zcb��87d;������� ���\���� � ��p�a�r ��fwwј��ޭ�[email protected]{q.ĉ���p�y�_l�q���6h3p���sva�e�*�g܈�ia�00�3�d֌�%��e�h ��iy;��s�m4��t<q}�n#�#�(x�q�'m%ƣ�:� �' �k���;㪝q��axs w�d�l�47*zݝ3�5��_�v��ь����ɵԬga(6ib����;]����1��b8x<�l���y���n��eou�/��o��28�)�>���=~i�׍}7~�m�^�p��!��b��ŷ���q�&f���$(�g�2���'�60u`��df���r����� 0�%l~ѻp&���xr���m�sj��~i�������ˉ��@�c�f���b��#o6�� :%b�htno&�bbre �w֭�dt| �j�cһbt� ���ޤt�n- &��m�à*���� v�myć%��h����:�� l�h'�;(����,f-wo�܈�l��g��w��?��m���bc�i�nb�~&kj��j��e��dm�ܢ�t�g�5tr� g��t �q�q�2��� gtڭ��w6�c�ȫms�d�ej�y��k };arh������͑,���-���� ȃ�'���1�1��'��!y����ht][�xp�i�������.:uwxo�)o�y۠2���ч ɪ# }�2d:�l.`i�6�k�t�0f cc��yv�_�θi�)e{p�s��'�p � �*&�b?`#����\c�⨡4��m?vr�������b.��%:qz��x�/ '�aq�dhhfd%��܉��h���bjs4�!x)我r�w��>�z �# �����q�a��@ �v����w��ۆ-x*[email protected]p�����y� �!� h� 6 y?�8 ��b���uofo�rj�n\֨�_���s?!!�nr����vv�=� ����ao��o=�ٽ�>,^ѵ�|"��o����2v�h�7 ���-���l�_��o���goذ�k�5�ip�ٿso؄ϝz݊d�d����������w���� �'t��<��w��2{e'�t<[o��� &�l���g��>�^��3���b�l�c��e|2>��xj�f}��'� ��g��e��g=q�_�cz�7e /v1�(i�݃k���u�#j�� "n�bh��j��ev��)�n��g���*f����iu���x��ԩ��xb������˺�˺�˺�˺��~�������v�.���y���j�|�ޏ�i�) �$�c�[�g�uºv�� ��k?�n��{�u�,l_�c����t��%�>����n�ԏ64����{����jd��ؗp�-4u����n�by�8 �j�.�0���33���a��ԏv�ܜ��l~���l!d�� �'`m ��`�ir�)��gyrp2��bt�r}l������e��*��!�dz���#��cv�gj��r/ƅ)[�0��-޴��zp�#�u�s�[email protected]�|�9��`t�g 풰i ��b�"w� �l����[email protected]�g���q��j��w��r�x��ɉ���v� ������e�4��6>�x/e{�gz�c����������� ��elb��� ��5~ w��ak4w��bϸw �h� ƅ1m�k��v�i�8��6�*? ��w�].>7���/ub�ʨ����o����� =;c�]iht���a=/>��ֆ@m�:�� �{m�l�x� �)mq�;��u?2�u�[/���i��9���1e�֟�{�� ��o({ �3k�#&<�a��i�e-���7qvy�\r� cb��f�ik��e;l% g� � ݃���7$i�@�b�d67�y$�7_�� f�m�3�,ԗ���в~/����28� _񹼪��gk�.�8�b��b {�5$�<��y��;�eupj`��q�e�al�7�ݏ3~��1ɲzlm)���w�{p �j�g��sa��ʈθ��~�ɇc�]a�b ��]��t� �t�z�t-$�'$b�d2���hb*��&�(!�%������o���=�� ��j���jݰ����e4^�o}��mpfߖ��=v}��t�|p����y��l>�6a�:����mac�d�� �n�� �9 ���x�x%a'�[�?s�j�ǝ�ࠩ`v��g��%�l!�v���'h#x��;ms�l�#\ѻ�zc����jˬb���d;9j�r�hl�@�f{ӑ[������/ә ��b���ad�"�x�@����͡���omrߐ�[email protected]�ȳ��4����/��rbl��a]ֹa� x��l����u�w�ly���5 � 2�[email protected]�cr}�2� �/�!��k 4yi:,v�o�c��8(���= �gn��t�]� .�p� ju��ۣ)��w�uۏ�-=8����v��4!�d%���d݃�dxꫩ�wo4���a��0���$1λr�� ��i^�e���� ���t�߻r��#�y��t5�wz�����š�m�-ik�u/r�=�wqf� �ƭ箳6ز:�� da?����������&�!h��v7a?n�@�艕(j�^�ͮ��4� ��?��l��ޫ�y�x�e6�i�ϭ��mþ�q��!�q��&b�[l�7�v7�������zr�s��q$��5�6���wz=�p���ܲs �e����>hi��cs;eu� ��g��ٸ��o��,qu�&�8� ����4#��osw*cg�l�j�������s�� l�`v��b�<�����ιmjz#!� -hu(��aa��� �x� �п]���)�[�)�޹s@p�������2��df�� ������e�z����]�f&u��{��?go�my�$k n<��6�����"��mg޹y�'�o;��c72gng���σeo}9�[email protected]��u��i��7j�n�&}�/'b�=d$e�53���e,c�x�2��?�m?���v���i���>�j)ڌk��a� [q�x�jc-�ҏ���.,����_|���֒�}b�sn���8�nj�.p��j�j�m�gw ����`tﰯ/so�iu1ѣ�������/�>]7놜�e�_%�p�v���u�r1�=��p%e�c� �=����-�;ɟ����( t=<���ѥ�s ��hj�:�h� i6{���ƀ��������/p�~�4')i�u0e�t��nq罜9�j�^䎌�px½�<�}���?#�3��e 1,fa ��i�~��嶣])�����n��>��n ~�ޟ��d7�uex{���vh�!1�q�9���յ�f�~_x ���se�ĥ�/����a&/ :y��:���cl)�֣����]_�p0�|8�j�k�mm�l>�o]ˠ��\�܋�x4���k�u.�մ�2��o(��f?� -��e��e�����k*gqz\̳9�5u�(.�m/\�v�ko(�h�>^���ϖt�!��>����;j�x�a��� @՗ ��`>��n�������<}l���2$���.��������ӳfá���zu�1ȴ���� r��a�gi;^��6~֒�ڱ4sª�j릢�/ ����)��i,a�t��(�q��v�����%�ݖv2\�a` "���s�}��'(c�������dc����މn(t#�i������g 6|={׿�y��bz��=6nj�d*�.�s����dxq��ӧ��:���)ٛ��x�6�x2�� �t{����_ɳ!w�9��$g��oof�wk�^tu�c�^ٗ���r���a�=2��%�ޖu���9o�w�� ��z�cfc�kn)�fra��i�b6�{�o~z�xu�u�s�a������&����2nq�� ղ����p������w�k����b؝p�t �����m�x��bj�%@[â 52��f��e���p��)j�r�� �ȏ�� ����s�g���͹9gh)u��j[�3$umae�o��(x7e���:�������j=�8�����us�ծڭ��� ]l����v��-`�dg�r��9��q�f�j��j}� @�>~���g�v�'�����zߝcx{o{��������3 �rd&�' o,��!��$p�q�ؼ8k ^�8�� ���'y�c��!3��v�ox{8����(�xxg��*0�b��m�����)k )�ǒ�b8l���'����ie���p�h�3&�ra� [���9!�,1`qc����c�� g> �n�[3o�\}ߍ� g���^ʦha��j�s?}k�� �w>�u]����2ͱ����?��p���k������8>�ؤ������#)��vs���>�ħ��7•�#�(��flnj: �vz��6��w��w�|߈g֏}xi�-�h��d �ՠ�l�ҟs��ރ�r�e��(��)�e;�z�=���a9�nu��]%kv���ǟ��c�� ��rдb�2�9ޣ0� �3nv��a����v�s�g��h�u_�f9 ��;��.�q�4l?m���̱}���3���e,c�x�2��?��-��ʖ��ہ�h�_��s5�8>̘��d�� ,����v�>nk��kvs ��]xv��wђ��d2��n$uq�j��z� &ϥj fmb�x��x�x�>xj �}�p<*�ʧ�{yؽ�f?�zͬ��fŠj0���e{���.z�g����� �)hn)��a�of��,xz^]��  w�۝j^vd�.i7� ��!�w��~1g� 0l������%���(�1�0'(����rd��g s������r���)��b��!2�������o����a�@�����; �y����c]'���ԭm��t#��>�h�c�<���h�7��u`������/_z��>v׉,��mn��i�m�p�2yy[\��`��ey�jo�=��ӫ���.n�t�ؼw�dž���x�3�6�0�0��vjn#j�0�����i�:��|s���>�ܓuw1�׀r�@^=��\v7��u�9�f�7ڭ]��ɂƥv ����;_)v�;`�y���o��@y�_ozd����z�l�.����jv�*>��izcw�[�ӵ �`�$8�ά�z�1&��r� cq����c��_���k��z�a�0�>ţm��� �ѫ����bk�����$�?���8"��a�u�ˋn�w2fc 1�8-��nh&��a$�ҁߦ.j�&����`���&%��rs�'-/�\hǒ� ���e�۽�{����oo���'s��t"�j��ҵt���4��et0%rrxn�m<���e�����9�(���x�t�us7l�l?�e�q�5ڲ��7=^��^��řq{��!����n` һ���g�ϯ�f9�\l=�.����d��phb��wq&/�����=�y/k�,s?��[�/���84dhs�x�`-�~��h� �7-�fq�ƪ�'t� � j��z�����}}�otܾ���m��k���s��k��[ ����p��,^hƾ��i$gw�~m�{&� .�#���b6%�)[email protected]��q�] ���o�^vz���z�0즜���?7��*�vh�sr�5d���ba� ����8$��k 1g�1���s[�p� ҽ_a�t���p��=��0b�#��i�a`�a ߻0$ǻx]��n��v�'����]�#�r���azk{��#)9j���jneo�� o4�jk'�޲�=p���)��2hs;n��7᧑{�:�%�8�ɡ�=zc����;��e3� ��jb�՘�jgy��%���1a������qa�?h�����q�`tv�=��j�q�b����|��ާ�����`�[k�[<�>�b�/�%=�f�a�9�� ���4p�}�n�υ� n����72��j�i)�rch�wa�$2u�k� `��ī#��ψ� o����� �z{i90rq����}9�z����n7��sп��g�d(2 g� =�z.c�x�2���e,c>õ�f���@�k2����� wjd���'h!e =�"���j8by���c�� 9:��z������4�y���i�o�m���� 7���[��r8:�7��[�rt[m��\t�j�4��z�vw{1=�z���в�ц���y�j_;���*/ޯ����jg)�z��j7�ā)ͩ4o���ۜe� ��v8\l�[ cjó&1�to ?��l��]��u�;�el΅�7�����l>�%���� ΍)�ɚ�,��v� _h��f7�!~i�v7�\�:u�~��z_v��&� `�d4���4o�j�bs[� �w��'��{d�����lrn9�����iѧ��-mpio��3�d���t�] ���!h�{ڼ�� �n�5m�v'�� b4�>��uq�������w�as��'���/�e ��vl��v �_������y��}�w�k u խ;��1��ar�5y����t-~����hro�zqˡ�~p�2��v�vycl�� ��%7 �1�wh[ |���ۙ�ln��te����3��hu�q�.s�����_�m~�d�^3� ��ي�lu.�.�.��x���ճ5ۜ|' ��z��#��rjm���1��; v���p�ĭ�*yyal ] b���p�b�� �����t<�����t�a�\�v e��aw��xu��� ^�q�sc��n��ş ]�轢>���0 ��% ar ,�4ow1f�`�a��*�����������]� ؜��=� ���!"��h������@��4-���o��� ���e�=i�׫xbn���o���n)�e�n �l���q9��h����p��=�q� r��ύ@ �o�a�1d;��h�^�]<�j��� ��g�zj�p�w*�������� 휅��y `�8z�>z��hjqb��7w�m]y&w��y��(�o����ac��cy�e�� �^��l���#����8����bѱ��ʵy���^h�0/c�����j�*�f���p�z~-u�l�v ]td��%u���� <* �֖c� gg���y���kл��s�� �����u1usji��8��'�ԟγa`ş�p| ��q�� wewm=o�� >b�.`�2�k���qnq�!��d-g��9�2�� ��mϟ߯@����vcp��(ɬs��ô1d�c�<#��49�t#ɍ�x��v/��pm�v|��s�9�/�ʧ�� joge:{~�=�����t��=����5��v�[�fb����b|� �ӽ�\ �sab7��c�0�գi�����e;� �_m�f/z1t�m��s� cqf�d�� d�tt9>kظ�t�b���.o� ���(_�9g� ���va�\鰲۶�33� |b�}��x��#�9) �e����|���yͼb��$}�j��t�kp����[j�|����x��cs���hk����b���r���u���0u0��tn!��q����p�5�)�5$��fo�a afń�rz�*�!��)�v����]z}��g,}��s�c�1b��������k�#ﹹ�� ��'��)n'��5r輌�g�a��wq�w)�bw�2nv�ש�t2yguk70w��?�l��v��|��kn�������ƚ��r��g,c�x�2���e�oo�y��;p��ȗ���(����w a��p�g �rf/%���_h� m9��3�㔣 j��ҭp�t��r�u�q�dپ�{or-�k]�3st"��s���v�u^}s����;ab���.�8���[��n){�k�-j��:�2���֙�λ�?p}s��y�ٻ��p��*kiq$ġ1��rw����y˗�e���� �����e�ti�nv�r��w�ڕ�� ��s���*��4gq͂͘e%{�x��j�@.(��� �n$: t�� 8��@��"����]���f���<���^�n�x����o ~�4o��������y�oj�'�����^������ �[epr���i��6�:��$�:ҽ����l�5���(�����}��� ���m8o��/�%�h�a`w�i`?����h;���5�w�c%}s���u�o�k�7gi) -)dn!s0�@k ��=��u>zg��jj`��!�ú�iusj�}ul!1�_y����ks}��usj�i�p2�������m��r�[����#�� f��5��6v��{�����u��,�bdք����b�$g:n��>��0�j}���]�ﺳ���]晹u1� ��cha�lpp"�qj<ⱦ�'{֎�雫�^w5si� �s��ò!���u���~���p�ӽ��n�w2k r�(k� k�ak�4ow1<�ɟn*������m���i)�d�?�蝉����ܠ�xɖon���ݟ����� 9k�6w\"�ޓ��{o�v��5����t��_����꣡rgh�|o��}.���<j�w�knq =��h�n�)�t}�� ,��;��[email protected])d�?i����b���r�<�:�f]?���=n��hl�b�2����z]ْ {瑬?���9;�_����rۢ�%ln��#dž|mh�l�9�l�p�zxsoq�e�g����h�������8�g|�ѓ$�d�˴�tm��/]vt�ec�j��)�(�0�]_1c�׾���$c!1i� �(5:��>����y0l��e�6�֥8���vhi��ybo��� 8��у����yշ�����|b��g,q�a#�.�0��.��0�'�m )�>hr���*��]���#j]l��p�09v3y���n�wbq�)̅� b��� �y�� ���ư���?�������x{�l��q�sl=q�n� �$�r��4ow n��x��@��)c�&�w���w m�]�h̞#:��[ҽ}w��p��my����k�黊���o��ȹ-�&/��o��ϊ���mj�3�~j�xpts0䊁��v��' 2 !��ge�l�"�[7ѷ=*f��=5x���8�&?��bha�a����<݁���x���q-~6��׊��w�ؙ�����}��[��^�k��0�w����tk��ݕc��p�t��%��]4fuz `pwtf�y��ڥi�]���h/#� �"��[�����͟3/o��a�^v1��m)]�3m���n���0vx�x�n�~��s��c���ژb��rhi�1us�k � �9����q �itά2�ȏ'���� ���ҁt?o�d��kc�������i�-}0����x�2���e,c�sۯ���t���,���szb�5e9���\�����-�(�$�[��#|������5������{��.d�����f7m��,ݚ��芩leyޅ z��/k���}�(f=��ؖ��%u�67v<�f��j}d�c�a����,���o�>��s����#�ia~?��/錵:��e���b���ql��0���x �o��r�kktң_i ���g�����r�� ���=8����b��;u���;����4n�8} ^�짷��b�qm��lӧ��ۣ�5_����w�f/���r�q�g�wodo��dn !��e��vt �玁wnȫ�†�酭�u �.�4zh����x �# 32v��l�a�~��>�m���)��#�a �gb �q�!�d뀎_���4��) l�����r!�c�ѕf���e�g nfpaq��z����(y��h��t���m��s�؏c,��$�p̝�*mʉ$��g�mґj�3剦�<t��a�?���{bb�� uo�٥�u���s�yfga$�s0/�f�#���5xg�нy �����tg�s��m�֘�� š%�ah���ǣ�x���[py-,�/��m��un9����b%�����n�7oa������?9x��~�:(��� 0r���ѣ���v�k�u��o)y�f�����wu/�̻j!w<�*��ny����f�a���p?i5�k�'k�j�o6��ihxuuͬ����)��ëp��e����x����84��d�1ɉlǹ�c9{~���z�rf�m�1� ��^�/ɣ`�i��[#`q����7�����gp| �g�7�����w�x�m�$���rjkf�12nv��ot%/2c�� �'颚*y��t�w|��;=d�ޞ:�_�w�<�ldne�0n�2���e,c�x�2���ӽ=�=wri����'�h�!!���)����m��%c�q`:f�8��>[email protected] su�g��h�r3g>h����8���= ["��e�zre����|[q�{e�#/�>�v�[[��1��q�;zjt)�8�d�����}�q���ay9*���e ���f��w�yb����?)�g��t�m�lߧ�u�]i��;[email protected]�sn��nhhb�� *𤈢 �"�a���(���!ɔ;�li��e�[��6�gf2��;����[��{kך��uw�ν̝s������;4���at$�u2��$�r\q5�t _�(����g�ϵ�ay���ax޴թ[2����a�%�������&ten�t@c��v�uc� ������"p���\�d�o��� ʆ���b�io���am���i�?7���&��h��rڈr ?.��@`i�ej�\ikl��}�s�ub�#t����1'4tڀx"t��ì��}?�u�״��g�g����pl���y ɔkq���y���0���q���b���(^��� ���� ��� j'b��ъy��]ź��c�ǂik�ǘ�]n��_t ]_����z�o��u��)��_���飂�ggkz�e���=�`� ��զ�myԉ��{��?����ܷ�55��g;�-ن�x�o�^m�l����}.���:08%t}�vm���$um�y��� dgѵl���z'c�$�r�b�v�g��-�z����`ݭl�7�5�� a�'��ψ�]��ⰼ��7a�0.� ��$�,u����eh8?�ea���qn���� * m��i���š!ׄpb�����^ux�w���b�el�3#���vu���\��= ����'�h%&��?_� k��h��w��'"c�b*���g����ؤq9c�f|vp��e��=�-�� ��h�x�r[텘ur�t� �m��|r�)� �/���u�x}�xs#^}�3��%fş3���$m�bu/�mr�.�ziu�i3���x_��= _^ ;loκ������� c�0c��5����\�w���٩ԃ�ēz)s3�x���d�⊤/6as^���!0�q��r��8z�d��o� �t� n�q����ݓ@�1��[[��!��)�xe��t���j�����$�>b.� �l�g?���u�_}'� ��� �jt���|i#� � !�� �俔�,ajr9��&�;�����d��(gxwj�h3&��։)�w�<@� t�h�a�ȣ�y���>w����-w����������qi�pj:\���cxd��hn���{�n��k�ٿ�c���ݵ� �dcc������y�a�8d�>f�-iohfp�-dk�e�����k�5���y�бhbg�:x1��o�m*mb�b��`]rc��p�#�ì�)]u�w�vp 弈�x�k�q}�h�$�r��bd���i���e7:v�l)<��zl�ӡ��`�;����6�')�mjkd[@�<�l?%����4�f[��^j_z<{��6�='�� �值)�i�i�jr��� s�j�:?�\�������z��l�<ш���h�_au͸!��<(��^�������?�m�n��0�#v7�鰄��*��!��:'�� 0�i����*f��kz`l�f��f\��xoe�ީ�,�����$�i�������.��d��c0���[��{p���e-jq�zԣ�?��¡���r/(ua�܃�q�y�� e���i�yd�p����`km dn"v�[email protected]i����w�{w�����a¹������.���[�gg�q������b|g�?bi�p����tk�g��l�b��.��qv�9����q<��o�c���-4��f�7!z'�܀�"�ӛ�u7�/ɶ�a�����e��⑋�/o��0r�27�؟r�oe����bdj���rv^�^z�s��`}�f4.t����7&t-�]4�q�uw"pbuc�����`(��¡�k����n�"���p��d�\v���zlb�ft�ŵ�?��j%�[�q(t֘r�dm����a� ��pm�ƕ�](�c���j?q ���0\d�"��� v�^/ķ����gb��z�t�i�p��p�m��ԓb��&�ma�:��]�'���*1�y&���� �gl�b�h�g�_m��гp��%أ3��ps-� �1��� ���� d��� �g�l1zk {=c�7������}(�6s4�n_y���f��i ?ŧ��/�o/o[�mgus6�hg[bv��ف�m�eƽ7e� ��`� 5���$������gք6]㐼��ku��� ܠo��ɺc���-�<f���^��ڱ.��y�����.���z�ƈ��tw"{fvy�@�d��)���b�l�qv�6c��v��z/by"z� ���wx��.�u����� ��ۄ�����sq`� ��n(dքb�����6�[�qp=}߹����a�z6��z��j����wz�7�� j�~��{���l�{�w�0!�ac���� vv.݉t�fdױ�:��.vk���(k�� ry:���l�眝_�y�s|߳�4&�'|dl����q���-�\s��gdv���`�}��tsqn�g݈uޒ���j�t�$)m�h�btm ���$vr�]�t���9�۴����j<`�e6�k��y�4µ����x���׶j�4�o���?m�����ç_�#md]�l<��kb�<�b}�:_j鴕���kr.��wfi��?o֟b�m����[�v��p��]�e����?��á��]h�fsq�zԣ��e-jq����-��w0�a�u�p�gp�?��#t�a�� �f~�-v9�glx��7c=06"\�`k�`�hγ� $�j�[����hev��.��p���w����q����wv�,�g:;���kcx�q��z?�p��o���> u<��\�q;��8-3x�>7�9�j?���5��}�p�;�{[��)b0�s֜3hy�ma�?��ol�}�x���l-$�h��ͦ\�̯)te������p�!f�%a�"ɧ�qm��8 k��b�h�r> �'�^b���n���c#�'�qgz�=�������97`]w���)n��g�� n6�e���?�#��k��;���(�p�ktl1v��z-nbh?f5�~����m��f���s 0a��a����&�6�� ��.~p�w�7$) ihqy��]d>(=fʓ�g�x���;e�i�?h�s7㚀�ŗ��r�v��'����g���(v�@6�r!r���$b�!�ـ� 4�m�w������7b�oi�>*�1��m���ށ=�y�gk�hyjyz�����vet�k�ć? z̐�(��ޅ�ewfj;�����>��oi��d�kć�1,օ�<����n#����f�k8�um���k����(�=���1��cp�>�4�!��!���xvye.�%��i��<��)�4:qe}�nκ�a;����-x%2��b���o���@gl3� c.dr-1%�����r���ǽ�mb10���>a�m(mme����"�s�v�4���b�1�zg����y놂�.��$�@)�����d����/u�;h��킣i��� � #gh���h��h%|0xg��]�� �6_��/��b3�r�7�_��c�n�v�� �h h;�6���h�䝝��3� #������_b��8����_u? ��]�m}��x�l�$lҏp�o0=uq)n5�#a�/�r>yq�d�9r��pi���آ� �쀃<`'����s���d�/�e�j����hmr����>_�r�ĵ��uڮ̭՘�t�!嵂�?d�z��=�n��u�7v��=�1 �a��v�Ÿ.#������2��k ����ъ����.d݂h� �;s{y���i�t�=�e�im(n�uy��.�r b-���n!\5,>��_�?�1�����mr��� ՚$�lh۹ŕ��4�ti7bt��`i�p(���on*��l �:�����ib e����2>��̀ .8a��hυ?�9t��c&i𷾒ߪi�!a��z�c�%���9�t�t�*lz �[g�,�� �wy��ό������/�x�< p�*}���f��w��>�|��a�y:x~��s� �< ���l�gmx��v ?l߹�(o�=� ��8�`�r:,$�f w�(; �`�r$�ɶ��s�҉ׁ� <�ܐs`�͸�}y�s2�o��n>��t(\����l�6b�{�w���]�_x��}�ep�k�ͽ��=�"0�ay8ᠽ]������q��ɨe�k��qԕf;e��p 䯯�@���ْ�wdo)%��o��e�֣� ��i!�r�f��l�&w朸����x���g�0�}���� 58��6o1�j06�v���ٽv\�jh5�t��/qy�*ar����4�i]���ӟ)x���d� �;�_z�!7�)hj�[of���e-jq�zԣ������� j��ڃiy��z����� ևh����ƌq�� m�„u��� ��\b��g�yojƽ�ɾ}yռ꽈��ad׌�.����w�ys��@�9:nȭ�%�b�d��~��/���g��i.(�n�����p�9�8uwƕ�a���^)f(%� �n�n-��>'v�o=��_�-��1��,5��]g�|"chb���w�oϊ*� w�gr������3����q&���v�i�͟,��}ơ�ȶ�c�pt�=r���:q� �nx�&*j%�s��c��/`���t{fy��i٫��n��-� ie�s�"aet=f�!�� �"=>v^�����v�s��;�wz;d������_o��bb��:��h���]�kd#z;n����ao�q�j;t��j{sk�����[���e*�b��kk�2(c�"���ւ�[d� ��zp.?k*kc ���3 ���2ux����0�a�?��j̾��=,���0㉶]gvyy�����fy~}qc�}��2|y=�9����>��>�m�v�r�dt}�e:k!�6�xq�{�5u�~�������/��b���\���u��r^_��m!'|�~��.�m��]˜ ۄ�2���[email protected]��b5��?���&�j_����_tv�у?�vh�"�&��|�6}����=�@���< p���x1֎�v��.c��,(cǵvr�k$�3�*��_b��̏�h���$o`�]r|5c�os��{c�vmto�zԣ��e-jq��_����ެ p���qa��gza� ��5��34�'�yp΍p�>��9�5���osfخo���&%wd��sf� ]���u]�q���%�yqm��kо�����^o��m,��-���:�����ݨ[ij�l i�����2�5a��mqw��shu5��|v%h?ƍ}gƽ�u� ucտ���i� -$�&4f(t��h��0�� (;j;y�u���*z��.h�w�v˟�/ַ���gm�l����jn�[w:o��zn�n�n�i�ϋu'�8��b�# ��a��8qڃ��ㅬ��@� �g���p���6ȩ�8�mi�7�u�2u'2��qo-'������;��'�~���i/ݧ=ۗ��v�c�5>�s�� q( �g��v�h�ӡ�=��mjj�o��mz���� ����}w�^fž�}�yۀm;����i��{��:g�*q�q��x0�]�m*v�k���\�<����kv�� r#��k��y�������%�ѳ��c�~srg��ề� ��ky��^�#�7��36a�d�갲zbw]���է��<�i9t���n�hv��2>;ۮ�g�q�1��r���� �"�?�tz*���vv.>9�9ٓ:��j>r9|���ݒώ��z\g<��� ,"�����j3���ȃ���քҗ�rvrkc��i�y f "��mail protected]�z��now`��m2;d�quw��^h <����*����\�{��wq�p� �r�'�?l���#9�h$���ۯs8�c���^q�?dxgxw��}��<�?�$ci��uc~�u�o�����@e�����_c�[|�gic��k=���j ��� ��8*��� g>>iw��m ��t5��˒?�ݾ;m�y�� �'�~���hy�1��*�"�� � ��&mv�=c;e��rμ���'����볦υg�ml���k{�s��k7ǖ����$](q�(y��$�ݏ4a<����s�o��tv����ue���"ٳ�ː�:��"��!u��� weu�*� ޹����rb��ީϯ�[}�瞖 m���>����މ�hcmr������v��s��;�jh�뱷����pr=����� "�!d$x�x�1fbs��j�� sgk!�g�b�g����l7�"0���i���g�6z�_k�h������1�^��l�]g��z��m����"y��ao����o�ؽ���] �;����n�й�#4̈́�9�[email protected]��d�f� ��?;��?�h斂���u�s��w�'?!�nes�l��o͉!{/,�����ʣy{u��8.)��3 � r�g�['�𣄻%�l�eq��&�������5m 7�l���j��l��w�]w)kݜd�d�7���v���}�>v��}8i�򮛾�_u�aņ��c���[email protected]�h�����ի��vo�%<�<������ͦor��zk��w� �y��;��cf��'�!��ֆi̤��}�� ��}������k���=t�>�z4s���x�,n���&5�~ �q�5��us� ��н�a��隇�$��2����v_mu�ẅ�u��x�v~u�h�/�� � @�����d�g��7�zj0b� e����);�=]vm5�o�þ�n�g0����4g 5�b��v���սfsq�zԣ��e-jq����� t��'g$"�����u�`�)������[��1���u.��k�7��}p53��m������r�t{���zf�m]/�ԋk���۹�� �{��ӻ/"k��v��\�ww��!m�u�ڋ�a�eobisڞ[�%�"m-rq�”ȅ{��fi�f:<&1;o���v�xd���_l�����ɇ/!r�e�e�>·rd��d�p�m�a ���f�c$�����&�wyu0�ħ`[�����i�9�v�=9.����o�q�ޯ��g�q�s����m�66k� l ,, kx ���5���8ɲdɖ4����'ir`��@z���f3�ɣ��u�l�����{��=�o���9��ф�{o��խ�*zѐ���nyoć/��v�k�è���d��%b�� �p�y�x}m�y���k��k��'��ku��b��m�1��×�������x�[�0�<��_v:��z����̶8����ť������h�sע`uls�<��yhʼn�gocfo������'�����n��om����k6��}`���|�=��|�:�e�����e7��~}��p~mj�'� i: _��v�4��g<�eѧ���.ظs�ϸhw�����5m���@��5uβg^u�yf^k�y>���� �r��1_��8������ yin��\���֔ϧ���<���~5s5��p铓��l�����o���w�s���[� ���(ik�lm �ygn,�:=���_�p��� ,dywi����ǹ!o�*�%�"`3�@�nr�%���ec�8���߸��� ߩ����|����r�g����nk;����� �h�o��n��sp��ݴ� ��� �ۀ� 픹gi i�!yo�xp�u}� l����ó��pv�,���e^ļ!ׁx��v�?}��??p�p����c-�k��ry�[~�s���-|w��bk�b��}3us�̗�v�݊!���g/_>���~�1㭃�߲�y�r���y�wy !��l�ns�{z�t��?n �� �$u����3�'g.����e��h���)�|�)x�o�^���,l�i%[email protected]��y�����,�5w����)s�2�l/mj� )�!)�{4��ʉ���}wh�^ ��rxzp�gw�f}�� ϯ��p�����?l�_�{�� ��7�����;潲y�c��_a�e�-�f?'�e��w ���::d�6dtcc�d��m�e���l�mk)����&/�0�/�~�5�گ1y([�঄3��t�w�&m��op�c%�l��a���v������#����$������8.8s�a/n�笆#�q\}�j��^�:�]��w����g�x9��(f�k>\��γ|@m�j��w>���|�7l���m���[�mv }���w;x���xd�7$��i{z#�6i>���/��q7���ܻ��7l�7f�h���� {����a�i���[email protected]]t�!el�2�)���)�=v�>�u>�l�i� j�l��܋�0��h}〲��t6��m�mk�=.��: ާ����1��s����,g9�y�rv���y;�j�=��z[��ey��:�#��"�h �:��~է6h�8�|��ߒ_sc��x  �԰@wt�f����>t�v�v���c��m����� �hǎ ���*u��ѻ��떼�|��:� 6�� 4tww �۬44{��v �#w}5�m��_�3h�st�m��� }}�qs &o)�g7|4��eќ����}js#� g5t�0x�t~ۭ��c)�qjh�`�n�\5���f�����u��%k�m.�z���/��� #x�8����%�8�ta-^ �o�n��]͙t�_���?�v�e�~:�]�y� ��! ކ���$�% y��:�{h�esm4�j��rs��i,25eچ���f�b���o����cu>=`�f�ݔ��kn-��<� �����,"�.�λo���^�^?��3�?kvd��1�)*wx)�8��.�p=5v�zե�c��?mq����w����}����7�t6�k���� ��n�r�����\�{q7u�k�� ��\8�m� �������v����4��a����?�=�ab�r����.οts����>����q/훼�l�dz.жf��u�\��ݠ�o��d��pe))b�]�����]���@c�eȧ�{�ֳ��s���[�sݘe���獸�p⢼)kt���v��иm�½dm{/����:z��_a����֥5uqb���� ��֎,2ƫ6�5����3_hsk</��;��m��[b|}kc�ǘ�����nȷ!k;�� ��k�=����a��/����,i�ջm>�/f0m�� u ����x t�p&�j�v�y�� ,y<��^픅���t�s�w('�/����8���y!4�6l��ƚf��ge�kt����2�d�$[email protected]|r�svɞa�*�tbt.��u$���7�1�hv�jpr(r�4c�w���iz�r��79h�k�r�lպ��?�w�{���o��ߕ?ai�ś� �ŷ(�y���a�z��hkj ~t�nٿ�?�h��*�����$��*��?w7�)ݒ���g�3�a]8"d]��=��\�����s��m"�w�%y���.�h��q��^�u�9����4����k�^���cj�or�av��@��u*<"h.� ���.�p� �\��������g�v��ۍqjjho�ƥܐv�eemf�>�0$�u��_1{e$�y2{����h�ߐ�x�nluհ������r4ne�����䏟��0w3q�r��snx��?���w�fvu �t(��z �]��#����w7)�v 5�ʆ�`�bu�v�ot��>:uh��6(4r��# �9�?�g�ko��.r�xz0�� 7jg.�ߴd����.w�>9��z~|苻�w?w��k�^���ŷ䫟��[�7iy���� tcnr�d��-g�3 ������~� -]c̺e=yiф�y���-|�`�����7�v�����<���^ta�<�~_p�y!�b퐑���\e ���v�j��or�lg��&dont�� �x-r5"m�p|����9�esz�u$�kuhnb�wjj�o���۝�j�}͢�dz%���=~��=���9�y�r����,g9�b �������!��b�?��sy�;��,a=cx���l���4ܗ��u������� ���1��i��o��\�kxׇī6e�9u]��:�;5��g�k�����`�|8n�n{�x� =[�:�u����g���,�mq0-��\*�m��ӳv��aðgj�eσiwn��n����k�����x�r�{�מ��;����������s�����[email protected]�x8�v��6�����4�� 2��;�h�zb�<4n.1�z8f (^i�z-x�b���?��y�qs���!a��\�k8����e�r����. � ����o ߔ�u���,oog�e&�-��~ h���t��$��x����y�h�[email protected]���n�>��ױ/m�f|�q�a�9,�/��)����i���;��v�֟��<�|� ,ͻ����(�m�'^��� �\ g>�j���$�=d����ߚ�|�������=�"u�7i׆ �_.xi���b�y�_ jn��n#f�˞s=�gȼ'gt�նu�ē��3�ra|����h�z;oc�н�n>h��#p�ĕ��ļ���䜇���8�-g��f׋� �o�c��[��n��sk� cs�as��vù�;^�=nj������~<��m��ea�r�[���@�>d��cf�qw��r��x�x�m< qdoc!-��~��~���q���e���a��%���uij����4j�?����أh�c��,m$�"3���.��[e�&pz��#���\h�",.��)��jchf"�w6���q��g�;%���v[���k,f2۶��h��q�x��/� kn_u�u�����������g~�s�� f��k�3�$�ci�`"#�hl��f��4�^�b�sy$e�>�l��?�����s��)7�)נ�wéנi �o��^ �~ �z �.7�a �λw�����]#`r6j0� |�ux�h�44��1k6b�r�\�ȹ��yhx >�,d��n��'m�kˇ�b/r���7���o%���(��φ��a#o�����n:;�&ޯ&�_����)�d%���7>�z� ۬�y ,~n]����݁f>�x]^��ԡ���ڰ��^�xew����p�cp��h�8i2�|�r��2��m:i��`��ǒ5��~v���{�_�&,d#�#��#v���[?!_;,�q8ӥ�bl�c�&��k��-k��=c3m�u��*�(.mv 7�z�m�qdqcqf���3^9�#7ish"�| p�� #.d�.e�ɱ��~���r��/�}�xh�g�,o���o��ӯ��j����v����$�d��̘�))c�x����]9a�s����oz���ͽg,�n��&masjд�`�j0�b�b�p��h�r0�6��~��_��ð��q�o�-�)6y�����fh�i<���r�w��w�� �eh�mp��p�p����j�''����t����m�j�.n�۟�?�\�8����t��ͻ�����m��ou��"cr��7��d� fų��y3�����x�mx�p�j4�n8a5q�~��o�z�>��9ҥ3��� �|��x־ �<�^m�� f�%����y������rkj�)�a��v��"t���4�5�5�'�܁&^&_gl]��e,x��g���}:�9�� ��av\�e�d�iڐ$�8���b1�s��u\� /r�=g9�y�r����,g?=���]��yyd�cj}l[w#��9��v��;v�c���`{,=�ê�����o��[email protected]���x�=�vx{ve�g`���0��{��1r[u�e��cz��"x��ܪa�5l���bu��%,�r�q�%����sė���g��o�����!���6y�k���� e b�vu��v��lkfeͱ��7��t�x7e�"����#�y��s��㺲cڝ'�;n[��on���%k��=픹g&�)���g��d(!��d}��elϥ����۳�����dp~��[�yd�����%ۆ��i1�m ����m��)1���\��zwp��ۿ����x���a΋�n�o'�.��,��='�cck'���ս�t�փ�!r������}z���r�w��o�������r�qz[��l9� ��cd�q�⤦�|>ӥ����8e�sd/0�����!�� zhs�z����b�u���f�� l���6��zai7q�s�j֫�d|ŷ�[���t7�v������`�)b�yj�yն㚲 ho���c�%� lx���euyȳ.���q �� �s՜% �ؽ�\��ơ���?������r�|2&@2i�66��`o ��9�� �vc!�] al/�de��3 �^�~�8�d����l�0�is{#~ă����e�j8���ox{z���=o�ɾ-?�v<�ҝa��۳��w���s\������2ۿu����� ��{z�i��؁c�li;π�c��u}2��4�i)b�ԍgf�� d�~dq��=��o���p�py ��$v�!��c���s���h[#��@k���i�����!k��p�b�ipzn=��%w&ˎp'��el3����n��-����f��li��n�� }z~t|$�?��kr�%��$t�[�6 �v5��|ָ��@�i���z l;)�l�p�b�v�q�3�j�'c`�b�0uª�`�qx~��ud�>��qxބj|4#1<a<ق���)��b&@0ث�w�s� �q���� �y��ұ��'�jc�"j}lfhl �e�d���8�x�gǖ���g�b�8m_��}�=�myo��~[io"�ҩ��� �����j�bk,�8��,1$�biۚx<~�����ɋ c>x4��ʓp�i��i��y���l��-x$���峿��ߣ�ɝd�:�u.��gf�9���/ ��v�ɇiche�uª�vٮӳ�'e�n������q[�qe�n�b�@\b�$v a%p��de(k�e-�����n���ɭ���ņ����i}���ee�pq]s�zoy�kς����퇴�oh��>b�d���ڜt�㴾u���u�۾�/��ϊ��������n��!���\rޣ�z} ]z}�.a�q��`i#�l&`ȅ�(@q�?z i �s�톬7����*��y}w2��!��a.�=��?��w�� ._�� t1�-��b�o� ��c��kiek��}���,g9�y�r�����i����,ѽ ҧx�^1���il�.��up�8��.��ҩnxd��<ach_�߃���a���=��c��$�`�b��!��s��b� ќ�f�#>�������ؤ���b�w�x;��$�y�{��b��h\b����y��k�������������z���[i��d�$�mr]�-������b{�cțb�4��!����ţ���9{ �<�n��s�e�&b{ 5d�?�/�t���tl �ݤ�b�������s� �~������ize�ef�֋�)�?�.��v������0���i���q�=n�z�88�b�s�> �.`? ���=a�0�ƀ�g6��!r��$�!��fh�kη�l;���-2p�hԉ�!�(�_��}i�-xh���nu�[q�"��wy`}'��g�b����^d���s/��?��:�8���|x#�/g�j�we�(l�u���vp���b �i��*��) �m�c��%0!$���c��m�( \x�)���iҕ��r�^d�l� ���|��~��m�σ�n��eܗ�����g-��k�g�˔���2�s�� �cxp��:��w�lyu=�� ]��q�^��%��v�3�! ��� u�����8��b ɺ�<�zz���:b�`})_��"؟���"�_$�"�e��"n��. l)� .�g����#��3mԧ�}iy������y�?΃mpq ꓒ� �'�-ch��~� �gpf�s�"!�u�ke>�6�j���#>e���n�}2����g솸���3��4�l]y�� m8  .��g��1�@x�?(?��� g����b�h�#�w��,���1�i)w�佋4�i&,��ư �i��c�!�0d��>�եi�>m�d��d�$�l �ɧ)??����� ���}��_�vw"��a%���� �p�wz3z��d��r^�|��� $l�bl�a`������������� ����"�2����0�pu cy��r��>/h�v���7[.h(6a�)b���c;� ��g�>��Š�ޙ�˖� $���t�d�o��������,g9�y�r���������t����� �м���m1mmb�7�4�h6-.ixnn�[�d�<oj���h�}p���x��cv?��ua�? �@c�ä�w!�3�,c�r�k k ^bh���4�l�-��������v�y!��ظ���,%qpq�9fjl �,�)����'!��5�i�hkz2ж��a��g�u ��4��l]*χ�#}�xbj>��$�� �ԋ a.���t�o����2>�i���w�~���gjm5��3d�x/4��}�����m��d�y�r�\���,ٲd9y�g�%h�� �e�u�1�1ȯ�����l�t��3���%s*ݫn�}�}ұo���]�l7'�(�)<<��ٞ3o���*rjo�iكg7n2<д8 qg�� ���t���s�5w�%$� ���m�`�t��j�j�^ 3l���ָ�if�q�roj;���7q".ƚ7ͤi$ 3�m,�� �~jdj�dn)��r7q�dq"՞�f�̘3s���s�o���n]hf_3�h��%@wc�5g�;���z)�*�/��x��='�q��;v�s2ŝ��эba�=�=r���.�p�:1�$rߞp/#n��l� �b�ȇ�]��l$ ���̸�s !ƅy��,��@�� ?8���?��ݟ�c���r��sx7��o��sj&ٛ���o�ow�a�}�c��w8n�de/av�e���)ou'�v̭7��5�^���lō�?��|�k� �g`u�@vѱ�9�6� � ��k��f���~��aqs���r�\c�gjw�;}�#!���(�kb��z6 �*��htr���t�ԍ9��fad�cm���p��ҫu���.�u��x} �`�'λ�j_��ypr0?1����߇d�8c. \�b��`ϗ^ ?yd�1}� ����w1�o�q,�b,m��7���rν�㢙*"�6�|֪p����s��6_{﫷~������e��k��}�jӹ$�~ ��'��{�i �3�h �؈� {��/�\�7�k�3���r ��a��/��s�ww�sq?�~��]��̸�β8 ͚��=k�ts� �q����`�9�,�â��̓d��o�jϝ�n�8���1턚w��[�d�t ]�*�wŝ���3�y.:d�"� �tlg�<�!:,�ڰip�];ܷ����g{e�s�*�bx�y�n������;cp} �qk�3�n�k>_������3� :��dm�5)l��3�!���q��s�4ƛ��̮"�r9� ,s�'����~��o� �ͦ�^��v콹 ko�틫z�vl�vl�vl�vl�vl��6`�z�d��;1i��rw�a~r7�7z�s��]{��'����nh�lj��l��d��t{�it7���{ )�nd �� #�v���7f�pqn5q��sȫ�kݔ{'����}�����w��[email protected]��:" _[rce���s�kɝ��bҝ�6s#u�l�5�i��q?/!��dl�u���zp�b�u^�o���ng{��;5j��椛�<�;$n��p2����h�b�9�s<�s�c�?�����χ7ń� k� in���s��/^������������c��d�u�����|�\���ղ�#�/����kg�|��߹�7�}j�ip�z�`����;�p�o n������ca5�d���`f})��b�:��#n�?$� ���x3j��. 2�#y��p��� �b&��!��3���i�����s�/o,w�9�d��ht#i�b'ԝ��'`q�{��s���z �qh�y�%5缽�m��[�����x�0n���r�o��{ƚ���g`��qq0�֌z�u�&���^�߰��>�?d�}�y���f�xv0wb���q���=c�o�횡bux2׍�������?���̇;l8d"�ί�k�$~a���c���a`���n��u� �1!� ܌����`2.�����2b�,�;�qp�[3b2d �ǽ���r�� �����yw� ֛ &ī��vc���x�|�z���j�x�s�g x�r���������g9��֔�:�3�c� ��"#v�%b��@�� �_$܉41l��#�m�{�����^�f�� �ɬ�=c"c"v��t�"��=q�q�!�q�0:�j&�jyw�mq�ޛas�(p5�qhf�-���<�m�t"������v�{m�ߚ p�7g���"�k��y����6d�~��=ի��i��c���}�[email protected]�g�9cn_�ئ��f�]�p�fh�c�ius������<)t�l���^��`��:��e��v����ݥ��u�碊~wb��[email protected]ٹ�����)iw�mg)wθ���������y~�^�e�ժl-��mq��,��i�g�r�?ߍ�������g���.,��ܹ��9��'�xv�ϊ�> `n����u�g�4as�˖� r�/����bi�6`հ�ѩɝ5�o����|k��wf����!;:fg#�q�cg/l���2ł5v>��u�7� �d�n�v�c3�����.�b,1�pp�f'@`��ʀ��;�ސvgؙ(��f�{�a�jx !ܒb���#��vi��\u���!x׺5�k�t̬(�� jc� % ��v 5�ޯ��r�r�0y�����x�=��tv�wy������x��6v�s��%vb�t�f g��m{�����~�g�{�o�ܸnj|�j]/�5�(�k��������j�ێ�؎�؎�؎�؎�x�ƨ���g�|����/����v݌v[�^ r���v�f�v�v�c�7#k��>�|����ȷ?��wu�]�ߧ]�� r4$]��%�n^���ۏbڛr��%��|{��۩�"o�)…?����o��b�~{���b�5�΂ ګi�`^$�� *���o�b�_�x(�o�����l�� �܆]kv��3�/�_z�c����q�r���j^��$ۑo��r�oa�����h��w�c��ѯ˷9�gr�>���v�yq�k6���c�ݞq��v�����߾f�]�ș!]�$�>u�@�� ��;�n���q��1p� �u���v�l�p��'��1��s�#�9u�p����h����ɷ/x{�l��z��t�0�m%;�f��='w�{��o����%�;��b3�� ����x�}����!�?`�g�s���j�ԛ$� j��o5�����55�>7��x��zo�/�}���}��^l}�cs �vnl�ޚy ꣊������� �=�2翔o�٢��l�uŷã��0���ʸ�@~��v�1j��rad��p�3���%�z��l:{̷�_����o6���q�i�ׁdrx�} n��!ߞrl���f�i��v�<�7 p������ԝssf̜x�b�p[����{ѹai�#�ĺ�hw|;6vtz4#ݒz�|;�o��q �x�yz�l w�_]}�������iɛcލ5����id�7�f�-��� �`�8x4�f m0�>e��#�y�d�s�w��o�n���֚_��u�i�`�=&άoo��fw���i5������k?���[email protected]��i��ˏ�e���gsrt�^n��"�o�������˷�ey|m�\��x�]�~-�����%�.��gt�q��s|�=$�}�$�����>���3re�a����|{w��~������\��cxa$�^�� ��[�/}{���\�֬��7j�c�ң!��̟�����bpl�dg����k io�&rfu�5ӭ�am�t7r����\�x��j�zal������hoȏ��b1��vφ�э1�|;q��w�i����x%7|;�|; j�� "�'��!�[email protected]�daă�kũv��o=��q ��k��i�}t}{�-�w�)sse�tq�н\�'{���ʷ~���^?a�}!��s�[���ٖoߎ�؎�؎�؎�؎�u\��)ia�3�d�g\d��d7'�����xǚ(ހtϐ8�w���[x�n$܉�r�ہ�x�.#��a�o�ۙ��s!����)w��w̼�s��! �ܟ(�-0%qpka�%�ԭx��n̻1�����z0��n�s�ѷ{�� ��z�o7j��`ɯ� e���鎑��;m�۩����z���c��!�c"���}ߐ�= d��e|��x�n�� g� �1�g�_�n�x9m'�j�1|ᕷ�����n�}h=��e%���˲d��ť��1i2^����k��>��_��)�x�7�ׁ�|;�v�p,��tda����ė$�[r���ۭ�f�>������s�uĝ���rf�^�(����ԛi�^��s��g�}�low[�q�v�avj��:����� kr`f��]�c՚�����0�) 6|{͌�nλ@�l� #n�r��v�x�[-�h&�סĵ όمnf տuk��3��!s�� _3�b��z��n?su"�5e�t�u'�"�v��j1�����n�����c �; q�h�xs�֊s(n�:c�r�r���i�����?�h�����t�o�{ŝx�i f�č���l �u���x�z����/�z���|�7͇��|�b5[��zv���:e�^�v�o>(�� �t�e�����́c�q�ϊkzx��.z��g �zce 4 ��x7rݜ)��)�>�d�cr&� }�m�ω�q{����@p�h�e�h4k������) ���j�ݼ��s � �?�� �q�:w�n�����z��,h�ݐu'�uk��f�,�u�iu�sq1��\3 � �9�or��vn�f�#���;��ɷc��t:���a� p�/��n�z/�x� �p�ȩl��9<�f6��b��o�۳o�ۧ��`k���w`� ����?��w�������#�.�� �rr�_�oo��g��#�g�� �x$:j����j=;n�l�9s�k������ b��7�^ʽlqc]ĸ6���?g�j �}c��닗^]�p{�c�{��h��;�#7��fk�w�4کb�!�h?�]s7��t�8��g��*bь ߞ��vnҏ"�#xp�h���?ž��bu���܆����rװg*��e�6�y� �m<�ω*�!�)��g�������� ��z�� �����c܇83�,�x�� ����%߮h}�����-���u�30{�'0cp=͖�z��h�re��/� @�q#(t?c��z�������}��ۏ��(d�d� m�#���t��=.�j�.�y�.��b�v�̗��j>[/�����!y��� g7d-�5�����ܝ^ �8)�>�xd�5"15�#� ���.��tfθ1��(#��%�*�t̞a���pv�v�!�Ԥr�|�p�:o��nw��v�3(xob;�u�� �o"s8�3'm;u���\�����ad�)^�j_fw�9s �����duf� � ��� �lo"m��r�60[��f'���nt�r��u�7 �l�4;b��#i�|�}�qc�g����������}�ݿh򩬁�u��װl���r��:,��k�kvq�wxl�ş���p��a��md��2ňba��4�i�òx�3qo�-�� �9�4{�������]h.,s�*��q^��iþ7��n{�o,�v��yg<8%�9 ι7px���>"���tv�uhq{ �(5 �zj����ҭ�og�8�cn!q���na;9��{3�f�a��th qm��v�t,�)���{�z�w�a�@q=��b�ag��x��d�����?ntɬ�y fv 0cv&�v��"&p��8x��o���uj ��)2�3���3�h�$� �=y����~�/���u6:[_��ņo�����1y� xҗ�0��w�a�g�{� ��e[c�m���5ـ�6�&� !��ӧ��d0e���3/b-��}sq ';pp�: �wa�} ὴjv�yc� � �c��5�.wz��a�3��(v�ipb:��4x������� �~��2nx��ҝb���2w�(�j�f�r���brgb���֜ j�%jj����1�9�v������qf����)�n��%fw��� ��c=��9l�#���ԛ�u���7݀�&��ޱ��\s��h5j��v�kj���f��u*��ܱa� �k�/�q�c��c.f ��3��ktnl͜���3�&��v�a�ʉ�0�;��h��n����<�ƈyc�o�t �e�#�z�����7��n�!|{�����\�e�h5[u�e��ˏ�v��5"�:j��w�a`em* �ԁ�4f���^)qag�[#��iq7�t$q4�g!�7�onƚ�ͮ��r�r� ��,u��� �9� �#'� �z�=$���f���l�(d����� �r� l2ϵ����֝5qv0[ 3�s9�>so�s�;������`�i��v3ڃ؞`aȉ��fn�yt ���'$qq�p=vl��� ��l�����=�\~>�nj���=��e�b]rup�3�]b��֣ \*�q��n .�1�.������;?����i���f_���o�w��w����o��n���1�f��1�;�ԍz5f����8��ς�>[email protected]���o���h q�#>l��4��t{(�e�����f�d�>�'�?��3f��j���^uu� ia�zk�9��q%qw� vxji�h��v�]c�ǀ�k�o��ǀ x �g����'wwx�r��9m� �(�a�бr����[�#���������կ޻���s�&g #.ygp79m��6��á9y���w�x v�v�_qz� �mjiq���pw#%0�pt�n[����}� *�9v�9tή�řb,o�������ap�!�o�!�w��j5�gl<�h\��c�0��u�$u�8������%^=��ș3: m��͎���d4�˷x�d�c�*!^�'�wus�b ����w ��x��đ�t���;�fha��\ȍ��(�c�b������� f,c~r��s� ڦay�r�b�s�x&j��*�]b�s(h�>n�5��'l�o�>e �� p��gh��� =�1͉i�f�7<"��8��|;� j�*��j^npj�j1ℕ��<����#2��7���;;��p<�-�^�]|{.w-��|�������t�x���!��u��<�@�e�h`g6�/y��~ed=������ș{bܰ���d����� g�<'���z��y���p�x�#j�y���:�5����9�1�����hrф�j�=���@a��2�r� t�j���u�n{c���1�k��<��sf�;��� ����o�[������r�z,��|�{'��\����%�d&gk��"�u����@#��u��4/u������ �i��,�¤�g��y ���� �{f�����v�\6�,e��>�� jh\�5���x�#o���u�_�v r�$& r����^?u9ʒ�zqj�j���w�ߞ�b�:*Ԧ�vo�!ʒ#�տ��d����pw�o�w��j%�bo>fc��`��qh` 8 _�� �̲x �g ss��'� c\e ��u�Ԭq����r&�rap�bv�d|;փpj�k��cd5��) �>��g�d$k��o_~���{���=��abb��ķ�t=��[email protected]���7z�5z�5z�5z�5�#� ����"^{ sf��h>�r��lxvs^=a w-β\xһ'� q���t�\�ja���6q�(�%p�9*�xg�e,5:j�s��dn rf`9~�����¾���q� '9� ��drҡ� j�(��θq r� ��ҏ95" ��q5ycmp ��n�n��d�ȷ �)�gstch�ь���o�x؁bno��m�тt �$�mqn��n=�z�o;��#;�9�;)��j�t�� :�\� �� �&��ӫ�p⵱�>{�&g q5êt>2��/��c&m-�6��o� -y� s�9��ka?�6&�-j\1�9�s-�)n �y�[email protected]��f5l��p�ϰ�� ��9 vw��¼��4��8)b��cbu�xr�;ʩ;tۢ��h��7e]0x!`�n�ydi������ �f5nr♎��2�t"x��u�s�f���x-e���z�ik��a�ta�ndv�0f��jdy$%�njh�����ty��ₚ6( �� �l �����ൄ�������t�aƣ�&1 w�d��lc��:��#�*&� av́�˫#h�3����i��� � � $g�?� ������ }0�?���fn{�����q/3���e�|u��^��td�a�](3�*�b �b�r�jf�v�g����9���|xr�ϗ�����%c�)c�•%�q'8wrpc&9�$�mjȩ�w��w8df�x���i h��is-�t�#mtbu �ux��%i#�i,�q���il4�`]��b���%-� �`�e�y��q<*rç��@�bl:m �в��v[��kx���abw ʶi��&��q�"��?���f,\c���,_ogg5d�z� "t�`���bp1%�d�i�!����d��[email protected]�4������ � �k~����o��d� ��������_�ϳl����y���)x�t-[email protected]�pe��r��]���h�����{�2��#`s��r/����ye[�ssx:�|�f����xx�&r�ł�s�x�!���s ��a 4)�f�n�b�j�zq�x���#(��g��e s���(v?���sr�e5� }��07�arv���qfe�wv�w�*%gk)��2�`:�{b�7 ��ѣ=a�� �����h�:��d 8�en�rj��j� �^��a�=��3��{�ĝ�ëy�|f'�}��!o��ԝ��v�\ &����֨���ր�r�7�ij�:��~���w�~f ���z���"|x|�ak���z�q�\�������5z�5z�5z�5z�5ڣ֪5�}4g�x�us�ʎ@���˓ �� sw�êr��d�'n�c�=�$1;k���)y^��ȅ�x�v�`�r�ʀ"��yr%0��n� r� �dn�no ��w`� ��$��x�v�� r�w؝)��6)ػ��)[9� ��b�]an�2�3�19�͸#f3$> $08fo��s�oi ��0�?6c�y� �ii$�դ�5h>"�s�u� `p�xq㉋�ϲ��m6� �ft�idf��2܋�:*�n�l�"�)�*�s?}��/�"b�|]l�z0�ek��[�e$�.x���!� c� ���`��fx18~�8�ix�"�pj����zԭ&5���s�3�(pw��d\y�!l�`-�(�td�x�d$o� �,#�< 2���y2�#c�fx/�yl�7�1؆ӑ0 �vѩe[��g�ə�$�n�2��m2�i�|ě �|np�-���b|�3e�1 �wq6�;��^xo��i^ u���g9%ʃ^��z�c� �7�)�β��9w����nrln�f�‚4h�kۨ�l�ϩ�a�y���<(� �@��a��g��~a��m�|�i����g<�c���z�v����������e��j�f�d���{�n�v�ߓo�d6�u���^�k�"\�s����l��p������^ �����al���b��0��›#� ͈�$h�^1�g��b�r�i ���� k;�-��7!(�1�#�w��r��io ���co���7i�)�,���ǘ��glg� � �pr��ns�$�)�ś�� j�i���ycd��y}���k~k���p���â�(���d��}ܞi���*婖ue�;�&� ��j!�p�{vlcv(���n�9���~rle��.ʒê�x�(�w�p3�0�qi�0�6�����c�?��?�~0�����peov�����ͷ�}ć��w�'�� ͩ%�0)�0�fg~��k�_} ��� ���}x��3h&�ꄌj�i�d���$#w��]2����j�#�m��x2뎡f�5 j�@r>��z��|��l�h�{"t"l�@ca���$ rʨ� ���f�2x���8����95^;@4hq�3����'�e�)�j�i*��tc��qzhp��d�7(q�8yg�{�_��kx �w���4za��s z. l\���)��l `����4 ������[�j�(�ޤ�]���<;գ)8~��/\{y�m{0�(�|z�x�|`��z)b�oo�fk�fk�fk�fk�ofâ� �/�����s�00ْ1���&c~2�'�;t��r�cu�\�o7h�~2�"� qu���l�"�l/�n< �/yg�fi!o�ц�]z��y�,b ����ij���xark���0���\�t p%f�(��������x�4q#��'�;� ��q�*g��w�q��m��\r'�|#�5�넼v��q�k)t3�_�r�o�%�� �-�����7�� ʇx�6ym�8n?ѿ�-m�gsg�q$�/\�q���[ؼ`�-r�j�t.����t]%_z���u� w�f�.�a���;��e�tg�a��!��`�9$ҋl�a�]&����h\�\���[}e��#�kr�0��v�� ��t�\�_�s��ݡ$/щ2 �!��p���d�hɗd�ğp��s%�k1l�xz�h��da��j������*l8�� 7�af7�hi��.�j�el|��kk�<'�xd���'c�u��n&��*;��!��a23�� xn�����y� m�bfjd4cf�d4�/�8m�w7yu� o��m��'�ڜ`gc%�"�df���� ���c��g���f�o���n��v7� txh7�ve�,�g2g_�w^w�%}l�x1x�rͳ#�"�ou���(� �kl�������j5�|w�y�;��wmbd�4��oӗg麡p?,��d�l� ����hdips�b�ő���{d�i���[������q���v{n�=�)lqh�x\2c �(��q��h�ǒ�r%�r�ʼn)���3�hub�*lbt_ 6)�j�z�u�f���(��<�g������8�6�b�3|3$�a2&31~8�,��f�ڳx0� ���&����sxvt��0 -��;v� ����!?�9�)|�;�j����ї��ci�accw��{�xa�ܘ�.0p�1��³�$,�{p����������m����������|;;��,��( ���og�%t�����^��0��`&�9>v\�b�xk(��������d!]?�����c a�'���2#!��a���`�g�o�ɷ��m2~ h-���%e�"�a�>\c�i�� vvw^�5jq�3�)�p� �g��d����ɠ���7 .l� � �^��d�e�g,t�Ԩa��8v#���= �m�j��`pfг���΂f5�$g)o�be��]@z>�i,^7b;6>�@f�ȥ�3,g"ƪ�¼�* a\`6gd,k�s��$�e ��(s�݀�!fkk����부���>��o}�����@���g�zr���*3c�ra/��bi�w��]�=͸�b� �����������j�r]���۴?�����as�o��s�s6�z�j�dݠ�o�e��q�5&8�եω�89�9�ԗ��4�'x{�`�('&9g���=��2ԗ��8'f8'���#��c�5f�6 �c�k�h��v�� v�q��'n �u���[���j�7]�b�5���������y�=�-]5xc�#̉a�p1xq��s����!���7���[���k��a��&���:�q�f����ǜw�j�f�:g�g����y�9y�o}kk��`q���vؙtrz�x-����v ,w8_�v�^u���v?sv�\��0�0]�!��u�v�x[���#�^%�(�a�@*l���"ʼn3ab�s$�# ����oazy��b�||��=�ۼc��d)aܞ i"g8g�:2�=�qv��=���!���x��i��!^��j�b�{�* �a�4�wl��&��dp�ѷ��i�m�}s���� ;ɓomk䓃ǫw����=�kq�-�g ���ǯ�[�2��8�xg�ja"���i[���9���9�pޱä`�����q0ala��$�_ sj�sw8�o�`�k��1��6 �k��d���'g89��⼓a�aoq/|��΋w��\�� ?�a��d�:�>��m*nr?�g��u�u�9ζc�;0�<�feɕ�^}y���h:\34(�^q�f��$�w��4��{t��0�=���#d�c���3�������ͷ�j� �ǯ�� l5n����xč�[t�g�;�c�d�?v5����c��f�i0� �r����p��h ��@%?��7y�{|-�>���ҁ5(@7�6ڃ\��ia���q� �����樘��)���l�0���)>u�(dq�&��ֆ�m���m���` �xb��ǩh"�24� p�7ٶl�m�"5�u' ��`��`}�}�nֶ ��dυ r��ޙk�&[��laξ�#� z�e6:6�l�ek�̂��`���r��ƀ����7����� x6eb��;ā[p�� ��4�a�1���4�vz6��� s�[email protected]ې��k3�a��h����w�����>��g�ï -;��-�l�u��>�^����k�j��%oy�v� �,�h�7z�5z�5z�5z�5�#�*zu� �u�������ssm���ޙ��|�y���k��,��\�wa�swf��8��������֗ϭ1϶��^9�7{��f[��ں�l�y��:b?�=sؼ�e^��^j�,�[8�7w���2�ѳ�ayj�]i����o���;{f��g�w�tyf�]����'/n�k7c7�:���v �d:v��`�؁�񎞙/����vv���]�܅�'�/�������mu�\�:{����u����y�2_;ܽ|��ڑ��#��#��ľ �����l�0u���w~���o�v�bt�w�eatxfk�f��cx����o�|k�b�y������=���3�k�- _�y������*?pn�׷��m�awr��jz1�2z!���z�r�������l����@�?)���o�7���� x�@zg[-�j `}{g�-���@��!���b��<{�����?sn�ò�t��s��/���vu��v���{�pn,�����#�{�u�|���q���ɧ.�=ui���i��c���[y>�7����a��gn}��37�u�wg���w;l�?r歮���.>uy� w���4��;}����3 ��c��}�7���uz��`,1_��u����;lqy;zv�t������}�o���y�l����a���}�a������[z������v� ���y|�aћ��ö���������i���v��� :�@��e�=k��c��z-��6h��y� �wg�t�oe�w�ݲ�ս���o��k��ml�\�y<`yh=��v~��w��a����}��>߿��?x��?��u�pv�,m��淗 z)��•bd~g���_����,��܀δ�n��n?q�ݰ�*~���ft�!a�^��, �������?~�<���?}c�ؙ%н�{w����,w��^���~�����kj[���%��gήu�,®n2] ��ӊ�`��g�pغ�#=s��y|���;p~�� �p����������/-�?�����_����s �x�|�,��a �͹���v�j�y����.��a���)�qt�������7yn�];п�􅅧/�0'��'�tf�ss����0��k��g�t�|��30�#�`m�-#zw�o{�hf��[9ڽx����,?�c�׿�� _�8���*��)ԅ�z i�c]�h�yn� f��\/�b��g�h�t m�f�]j��y�n�'�kow��?c����n�xk&��2�r�z�t�� �� �fg��p�� �@׳�l�]��ԥ�'έ��ť��/�1�u�lw�0t��ə= f�, �.�s��>>� �ώif�z�p�.�6a\�����;�7:�>l�����t�n��k�c7ϵ�ͷ�^k�y���sd��.��3h{ �.�),�\�����|퍝=������3�=kί�t}?�����.3����gnvu�j�~�����ytv��t�s�p 4g�;�� s��cg�;{�ع�����,�2����������/������q# �1��a#���ݳϡ�]�:{���͎�v�'�2�yi��alv�e��g��g�y���3g�����s3`��0�� 1{�h��=���4b�zv��_=h��n������?h//,��)r��� x�y��v�y�сrݵfh��>u[�fk�fk�fk�fk�f{��\���?r�|��� �'��/�g6� �� k߿��ח�o ^��s�ϕůi /yw~x��.����k� ο���(��h�yqp����n �yһp�6�m����wg�;8���j�y�����ɓ�9v��i�5xڋֵ��k/�&^�y�?�9i��2�o���l=�e��|rp���������� �v�=���8~�>����~pi�����ŵ�i�_w.?�>i9m>e�>=�|z���7n���vjp�݁�wv� ,�68����i��7��?so��k�/���_��� �sqx� c���|�m� �� �6c�i��o�c�%�� x�� �^^� 뛯�n���ƿ�����k߹:�_ɨ�|�����j�zm��l��\zo�t��u��z&sm��b�/������݋c/\���m����:�c��k�<��k8�3�s'�s'ms'�ӏ�v���)�l��̿>0�6�-i��ҷ˰�/���.��.��i���_��wn� �g_����յ������}]q�|u`��w�7� b0�82�����.�x�қ�_�����]]|�:}�:}� ?���k7�å������ l�lwo�����u���o]���m�����ѿ��`�^�u`��� ��oۗ��c'q0^��x�:�?d�����^?5������ ,�>�xں�����s�9q��8��)� �y� 2�w���n��m�� \���������8�3�?�~���{�g[ki ��(�η��z��ly��y�׶�hd��(�$0��d����"�����=���꾯:l`�@-a~��>��lmuu}��ߪz�\wtm�\tc�0��wmlx�(�~��^�z�� kb܁ï�{gw{} [g�z��1j�*�'=��-#x��� �py��֡2��j� z�x���5�=e�`�� ���; \�2��3��m��c��u���[ ��1�������_���k;;�o�%r�b�i��j�l��%���q�(.�s<;w�뻫o��/��������.o;��u��u���,�z\3����g�;�oma�z-b6[�垑r��ͱ8��k0���q�9|��y�[�ty{�4�l��_�<��u���θo��$�<�n�de�������~����s�}���7ퟬ�yϋ�} ���d�g[�2 \߂�����*��jګ�vt�=�ѷ�ӿ�y`cs?������w`�َ�m��~�{�v��op�wpe;�l���ލ��!|<���*h^��zo�zoφ��m���mn�*o�z�2��%��;�|��s=e��7xomn9���̪���w��cw�����������- �| zǒ���pu���才��}���f^�b�َ��u �� ��s�rfs��uޞjo���%���c�v�-x��`9�jh g�<=&��^�\ x�9��=�g�g-#�ѿ�s�f���t:�:�����y�ga����2jz^higr��ω�?���މ�u���^�ٻg��l)g�^0 ��k�tvt؁sq��19pd�q%�������=hg[gvz&wy�kz�-�ʖp%���ys%�� o�/o��غ�op f_�� h&��i�z��z��a�� u5����6���e�0ž�l�j�}鋁���a���-�l�d ������zf����7]�|� ��:��m`u��� �ݠ���a�,�a'uu��6�q��fx� �ɺ������#}ϸ ?l(k�]/� u-�o0%���*/n� �m�7�¾� {����*�p����l��{����ξ2���w��w]�`e�des��9p���}c?�;�y?z/�q��s�]�lp`~x��sx�=��l\����}�-^��v�����f�>������� d�i�0�if�k�rnǣ�\d%�g��0�c�;�@ �ib6��h���c�x�=��$� ;$;#�ca�����\�`x�d�;����t{$uz.�?�<}o9:�tfp����u���7o��d�#�#���5��x��x�mt��#)�p�#��eԮh�p8v<9y/�k�gr�o���dgl9 -�ļ����ꉩ�b�/b�=��'��� �nf�ݑ��hrwl�-/q �8� ��ͥ�e� ��<n19� '�d�p�x�1�md���#��p�l8u4�vgr��t��?�@''ۢɶ���4��!��mq ��iv�%��#s�c�lg4�et�q�@�e������qkbn0����u��<�y��l(� bwxfe���,m�k�1�����є�rߞ�`�(���x�o�������h��,c2�8n�g�g����g��q�%��e#�a�#� |&�$�c�}1�6yln95���%?��w&c-��ȱh�x8n����q0g�d8y"�8nf�g�1���p�;����\��\�d8~$=�te�f�h��p�-��'���=�x�=a����7m��dbg�r�s ܎i�yw$�ue�g�����p�m���ƒ�����҅��84>���"éc���0�asl�s?���;�8�!���z�c��?�m�6u���csꁹtgxm� ���g�r��m�dpt��l���䁈u����$;wq��ΰ�q�^ �%��&�d��xc|"��p5�`�����z�#�c�ۍ�0ad�?�i}�މ��4�ψ�1���xl���s��'�ҫ�_�lvz4��7 2�0��@q��}  ��qh��u�_�n�; ���r��ar��jg�������x�%;�a �^�� 5ēͼgq:i_��cf��%c;�oҋ�: a�am6&b�i�fccs�����0d��5��0a\� ���vti���aԁ�|, ��tͥ�ê7�6g�}�0d��p2;:��6�ǜⱖp�h81n��%�%�~�b�/�=����!ie�ӧ�bji�*��ğ(��d��q�6sk� aȉibضc'ko�t���j�`8�9o�@*p��� խ�tk$u,�� �[�bh�$��,ɹ�[q�{j�rgo���|��|v��mqu[lm�&w��`0š_����a�ʺ �z0�j�ƣs�!��)�9�v��⍨��o�\ ��[ �؊s,�5ygb0}�x�g��"�6x�׃r&<v���s$�j�r�\���/�~��v�ø7`�7*�f�v����ft�$'�ì��l��13������� |���i4 =v���/��=�tk��q�h4��l��� s�0�����!t{h?t3�sp'��|k�m�zc�?#��8�b;a��:�����p�3� �r�c~0zs��u!���� ü�p��\�h2�ڂ� tx ���3r g"��<�z�a��bd嫁z�p���v�@ “ &d��bƴ`��ߎ�6� �g_sq��7f�>��yί 6#�u�/q>%�s��)�����/rf��[email protected]φ;��y�����*$��2���os�gɛ`c��qn�\\��,�koak�$�����]����b~�f9���� ����� 7��/�&q��~�9�.�xg\\��ׄ��ۙ�;䜼�d [nls��,�p� �,�0$_�c�~�u]��qfl�ẁgs8c\,�y���.�y�i\3x�q�0 ��ed�y���]��s�թ��}{nkb�� ���c� f9������k`� �a����} 47�moĵ����.s~ ~%�p|����h5� n\��w�����\xy��w��%���ӿf�,pa��s�x<(�o���������f`t��i��0����y��i�yq���kc�ҙ�u<������0hz>����y����ct`�������6�����/�%�b!٥p�iٶ��[��#8\b]��nl���ip�'|wd`�@6'���x�ho������!��7�r�������a�np�#�_h`}���t�)y�����i'[:�n���͐�v%�ċ�m��v 5 �8��4m�\h_a1l��u��9!?��l��p�/}o��?�j�i�r���<'w�ދ��04�2�_4=ą ��>����g�1�5� ���lb\b�>�%.����l�f�afi� ����o���5oh7��� 2ђ�õ|��%a�phe�0�� 3�o֬��e�_\�a���fh��u�c��ˮӝ��� fp�tp�5z]�ѓoa��� �oqv�� �ap�p�������m�n�]�x>�s=��a[�~�4c �y?���o��77y֌�b��i j��m,a�0!y@�h|�-���5��t 8d{=$5�ɜ�=o��jbvf2\���y�|0�jg�)��x��x�*7��da����@�_�e!�� �[x��!��&{�8���/9p˹��r�6s����mb`t�u/ l�9am3��9��0��_�c�a��`���y�_v3.2 �\�;0'���b���յl�0����hnۦ[쇅u�薗0 � ��!q�~��\ąh[z�����n �@x��(li�.���ɉ�nwk� ��g.)��b̻� �ퟻk�vx��rz��νf���u:�c(y;��l�(��$��!� #�z�n0cc��t.��v3tn� a$/�u̅�tg0����?���(�q� �>�d���vs;�(��&� �獙�e�cm�z�jk|�� ���en=3����l��;��\4�� �7tt��sg_8���;�߲��y}~���l�(gg�;�, �"��\��nk�΍;6�o ��5md4�5����!���cz/xj�lf�od����� w*j &��y����sa�82ۣ/t���-��uk���e��n���q�r�"^��,�!��� ���b�p�͢���8��->n.�e�) h��9� �=�%.��dd�y�l\n6xp�v�.�<��b[a�5���o�a�ȹ�'o[�u[email protected]�yc��^ߥ��� k ss�a�d�r�1dќ�mk�t#5s�� -��a���@ ��th�t�%!�'��k�|[h���]�t����_>_|��� g�z[���a�p7�s�g8ϸ�1c��~{�}�z�a��.�;2�/]��ɩ?d�,[email protected]=u?b�9���6%�[email protected]���mf���v.����kggvq��x.�y����j�����?l_��x��}k���v�u谥��y��yi��x�đ�)��ʹ܅����p>)�tn�؟��b~�bv�� ������!�q�xy`=�0�,\�|�䏘��k뙷�����0�>�\�'����n���vne���xjd8�v��߽;-2c�?��:� o��0������i)�@ �������4t]ȭ�>�ϲk�|��%�_9jca �����`�j�5��ngk��w�ai� {|��ޭ�����(&�t!�kհ����� <����)â�t���e}�…��#%�hi�yan]v��g�c�2�i\zg޽�t�-m�`j�w�b��ϙc֮ny��a}�����@��ޯo7q�喚 �����5 !h�@�g8nq��[n񨁤f&k/�m/�.��^x˱�8]qk��1׍�'h�n��a'(&����!��q�d�s=8#=�z�xur���r��(>���7���b>#���� �k?/����5 ɜ3d�h)2l4��w}��;�����ï�g�p�e��9�i/�c�z��� ���n��@ ���>z;>j�f�k����;u��֞���� ��u�(�p?j2���k�x�v]��j�vs�g�t6^� wz���i�j ��%�bz�m�b�[�;��ݐ:����)�>/4[a��k1�ݦ����֮w�q����&s��ez��m:z{a�3�����d��a4�q�<���bz�=ޑ�n �@ � go�lڛ���s)��z�b��z⓬�;`��j���g�e�9��”cyi͎��w��,px����b,��ve�� �!�-��.��k�v6� ��r�cw�vimi���w��s2.aߪ��s��<�r�� :ߓո�(���x��1���p1q1�!��ۍyq��xg$�v4�ּ�����bμ�@6�wsp2��$��@ o\ʀ��9ѿ�޾(�ݪe����^b�����m/p?���n��b��{dum~�gݼy�$#�=6��hop��1�c���>r����q���z����� ��ŀ?��tc�a�ꅝ�h�c�ۉ��t��>����]���4�l'�@ �f,���/��;:�´�yzv[>z�)��{��6��6���x���.s, �d���d������o�p���jy�q���m�l�6row�hifq?�y�� �s�s��r��6�ۗ q*ho'����mkl��������z��������vׄ��f1��v�@ ��gf�l����hz�xfp�"5u�.w[��qau �n &m��n��;�6�/tv��ҽτ%s�5p�ٲel����'̰#�\ĸ� ��k%�f���9i� y$� �vj�i>@xn�um]�^����y�z ( �����j{�lv�t�k�,r����@ �@xz�dz��s�ѯ�����?�xz�=�eb��j��.r���z͒�nx:� �����g����!lz;�@ �@p��h�<߮�"���d^��:.���@��9�3�����r1�0 ]p�� �e6_�g��b��ʹ�uz���bpogb��]͒֓)��� �f\��lj�bn�$<���am�5��� h ���v" ��� �� �,�b������@c� ���'k1�]\xd��a ,�ksk�dny �su2� za"s��:��}�|��3s��c�3�?1g80��%s�/ ��5��0�@ ���to�]0m�8��̡\�mq ��p�˙�&=_,�z����#�������������z{��|5�2�rߐ[��<�~o��%��>�ǚ*�ˬv��-~e��с��p�,�^�ô�]��pd �����n�p����~�1zr!,���5�kp����d�i�&ƴ�p��f���y^��"#����d<����)paq�0�\� �df�&��h��9j�4s!�@ �v�_oϣ8�v��?w��i!ғy�ۗ��]���v�gu�@���r;5l2�-��� �2��a-�o�i�iy��k\"j�wj �. a-�a��u���>�`#���h �xu�e�<9i<��kx�~rh���\��mw�l1�z�㜬f\f�c�����w�ҟ̳��ob����β'���x����:ohu�yc�n�["�q�{؞��2�^.�sbu�1�x��in�a&���6$�s�@ ��4�qq��&ɬ]˸�nӄ�����_e�匸��k����ٴ�f�*���i�iy�2�ϋ ���#��h�k������ t��4� ̈kyq]�fv�d�-�p2#nd�� ����8�$�i���ln�ɉh� ���v_8��{1�)� #��>�q7�n�uj\n� i~9šmw��^v܁֒ֆ����g���� ��wl�h�sp�k*&��2�$���uq.-�g9����x�c�_|5�b͉x�xcw����w��z\�$ŭ���w��t���\�%�h/_�ι���j��¼���q���j\\�� ����p1!�`(fy/o�؁���*�*f�e��*��b�f��w"q� a���*��r�3#�%hx#�d�`f4��~c��s4�r�r��þ�<��io'�@ ��z;cg9i�t���匢�e�����j��t�-ux& �q��jpv o�~�pv���u�����o�޻��=e���sn�� �r|7�#7ѿ��l�n�n��n�ݒ�q}3*�黡�����i�m�ψ�� �d|w��h���"�������w���� ���x⚥��0bw�wo��n�3������4����c��p3j�2yw���e޵��� ͂y�#�*��эt��ۙ������- �t{�jߌ2ps���a78:�>�_o3m�[ޥѥ`�'dl��ȉd�ݾ�=k���� �q�n�^� \m��h��lo̪����p�ah;����v�g��t�;j?���\xw��}���v������\c�\o� �mf,���� 7����,�f���μ��;�齕>3�φ�b�["q i� �qo�薆h�y�ov�u�3���j�o��8=~g��k��u_,7�ȇ�f���5kj�̣��@ �)��q{n��04a0�s&�����ȅ�����5c���6�^��m��z}�<��ޱ�gl�g���_z%��������{����u��'>�|���a��ǭ��z�>j��m�=`�����}��>n�|�~��g��3����?t���9��֑?��|�6���ӊ'�rwuܬ)�-]�$���g(p_;~n�����9wz�@���������z�z��zƀyf�ú���cv ��=b޵d�}�k���[� �>d���}� ��_;}�'�ž�����}�e���_zf�����c���n�5mc�2��g^0�q���@�����v��}4�������m�#�xf���mo��������s���w;f��1���q��u����:g����y#h�w�#=8���xuw�c��;-�?�������p�~jf"���l��̉�g���'&<]#u���1���w:������}^��5b�@$.�u�1�n̅�� �in�f?i��:� �c�n�ǝ���g�c��7|�u&�uf���c�f<�z;g3� �o'�@ ��3��yf0ea�q��. �t#��7c�g�v�|{��w�n����ꎾ���l��u}�o��n��m��[ [_1�4 �����ׁ�z���}��d����7�~������_������zs��;m6�nm�y����}o��y��wk}�ˍ��w������� ���/7�~���_6���뻴�^��.ta��\��� ;��vc�è�ⱳߌ� �h:��'~�p���o4om|���u��l��mcͽ�8�vә7ѻ�^%�z*~ڻug�;,xkg�m}/7�a_��e���m�� ��/7��ؿ��kc�kug~vs楽�w�omhy �n�<�����u����� ��y武�ך_mz�a�w �o�����gf���5��ng�ow���m�{mw� �����e�w�ⱦ��j�'�v���_�:���o������_7�z7�/���r����ޟ���� ��i gc�ِ7� =� �]9���iө7v�|����5�ʧ�i:� ̄=���4h$.��j���ڎ����| o�����oa�l�{kg�[������_�8�fӊww��1͕{s��ޞb�<�t ��鴿�@ �@x����:� "&���2�yq���sޡ?�}����u �f���7�nl���i�������f�փ?���\=��zr�f� �__3yy�� ��p� j��5� 5�u5h�55��k k'w��w�'���k��������/��_���t�px����6�?��x�n�ؚ���m=5�/=�� �ő\r���8�o9c��m���=������6��zzr�=��c�3���2�h��z������py����ұ�:�n{���[u;yy; v_��/k�x�0�^��e5�u��u5����յ����������s��ǎ�5�7�&tu"��k�,a��msy�ʋ[�'�����oӷ����k�� �c�ln�o��|�ֿ�~bs��f����a��1��qre�䊺ɕ�hc2h&#.v������p�gc�'7lt~�h����)-#pu���$�r��jk�ʈ�����z!%����<��q|�ήm c�k���[email protected]�g"qi�a��seա�&k�vքv�a�\ �0��x?��ѿe���f^���xs��;��źѭ�x��\�og,ʹ<̲�� ��@ �@xj�x>� ~o���b�q �'�;��9�:���3?n��9��ɿ�1��.�bmpkm���kc?� �x�p o(�rx� �� �� �����ʫϕu�[c|�ysvm�te�������������ъ��g�c �������چ���������цʃ���uus�jb�t��gm�;b > u�����x���o� cc��v�f�!� � �>������t3��~z]��յ��u�~x=������� ӛ맫j�vʖ�k-%�own�z_�� �� u�4�v4�����z?�|��u短;��ա�j�i��ԟ o�~~��o���p��j�|a�����mu}���_]�7�ǝ�ޞ5��sm��vm�|hs'�@ � �휫��'-'n_�s�3����wov��o��k�u5�m5�͵���>��vj���� �r�th��g�˟ܸ�;���b�$�3���� 0)��ƛmrie�v�l�i�5��fhjvd[�t�hb�ie�v��13�~g70��رn:�l�����^���my�.]�o} ��i����~�{�~m�h�s<�0)��i�!u�(�ޞqpn��#��k�wm� -�梚�*..9�`ӌen�xj�.���ȓ� k� g����o޽4�o0�=�����~��w�z�˫�e'��t� ',z¦y �m���i��k3)��mt康lるr-�g��/$z�`����nфh��k��ư�n�/���~�݉�q�3���e�og�݊~���û���� ����yr�b���)�r2o�e�_v���wiyp���-֌l �9(υ {�'�$m,)[email protected]�.=��m��ܦ�z�n �b�9a��v7����u�f���~�� n �?����h�����7/� �܀=�jw䵭����(�)>��d��(�[��dlx�s�o��`��a}����wv���bg��.���{��w�vv�=��~?��sk-��rk-��rk��g��ߋ��"&�߈���x?������;�~���^y����`�y,,�d�ɼnky0i�'f�3�,;d \{� �b�a�)r聬�i�y4)s�-*zlvl"[˪�/;�i�_2�ݟ���=-��i�؝��_~�<�n<���o��7�z��m�w�-����5�f`� �؎ތ���~���`��y%�vo0�ao��q#|l�� �)�hae*��>6�n�^2�a�&��\,���*{ȃ 6�m�e�:�4$�d�� ���k�қ����}&5��~a"ُ�����nt�ntg7��û�� =뮟�7�p t��� oi"e#u�,���ï����"�[email protected]����%�cd ��ږ�!�]����*.�g�緔�m�b9�f���¤)�[s��3�����m����`�;ގ�����n~����u����w$;<ŀg-/�l vg�p%)?�)>�e�bvsf��ѝ1Œ�[email protected]�捠0x��$����*�d�g^�~��۫w�޾��1,�o��x��v�{q�o�=�ޞzj���zj���zj���<�t�qt3�v��!���;�;���_��/��r۟q�i=ޠ�*ͪa�a�)5�ҥr3�5�i-���s��[:g҂fk zi�j�� :�$5-k����42���n���� �e�?��'ttf�^����h4���y��y��n>a]����^�n��kw�;���>���g��p���>�{�xw?�{?zݿ��/l�'���:>��?��g��3��#zp��ft/o i%hs#���ʁ�5ȓ�o�� | e kr,4o�5��j�t�bњ,�fಉ ���t���_��ݏ���y ��`��2�zí���7d��� �r�fu��vp�lgya�&]h��-[ނ�-_�|���i7pi#w*�6ws��u��y�t܎ؾ�s;sfpj�:ݼ6ݼ:ugv�-����7�ۿ5��{=��8�qk�� �����yin~��=f't4m���(χ�"��������ǵ�cz��nq�*7�@fm��e�.*8ތy���#�r;b��w� ����{��v<܍�l��fsc��h-��rk-��rk-�o����w��@o��_����z���l�j�s� � �ur����z\ 2��>n�'�`ڤ��5��b�r]!5����<��=����{��_�?��/,��������>p]uzuɢ�n��-�h^òf��]'��5~�c�:^hz�/��d���4� �f��x�x�����߾���n��~0�}���o��� ��o^�z^^�'t��g�vy�ُ����������e��5 \rimů�q%��u���/����qlo2�dol$�[email protected]u�x�[email protected]�8s���ψ_x�g��ghm��m���6�?d�� �*)۞����ެޝv�?����ksφ��x���v�np��� �ggb����fz���j\�q�g������=e��n�*u�򡢇}(>a|x�ة�^9|�q����g�_����p'�d��q���j�x3|���j�� ʎ��d��9ןq6n�|����do��w�[��too-��rk-��rk-�o�e\ۅ �px�����q<��w������_l�w��r m�tʆ h7��4ߠr�( ri`�,6�_t�$�&ι�h ic��j.�o�e�؟ǀf�7q���$ �1�stq\���&a8v����j:v����ut��[�� �ܦeret}�h�đx�4�x{���ag��x-أc�|�o���������� g�����u�_r�e���3&�5=���u2g�2n7���dwsɼ������k����ʒ�q��g�3_�>�az��������-t��^��#����3�,��voٽ) ��м�lts�ak*�k0������}z�!���jfޜ��8k��x�^h������o �k��b��ݧ�1���??�3{w��d�&y�g���e ����_�: �v���:*h���蜺�_6������t�t�/��0�� 8�=�p�=��֛7/�l��?-�d�v�횱]u��piwt�&e���m�h���a⬎�u��=�9���աؙph��1�����������8w���(�k�=,��}�v߾ ��{��}3�}�9vc�hך�x�jk�t����l&=�q�<���*�[��5�ͬ\˜�f�ҙ���.^|���f��go�@��ƿn��x�[�/�^�bq n:צ��rv yd0}�@u���>�vl6�/w�s���> �&�'� 7�ܷ%��}>�a� ����<=��d�c �� ǧ3����'ȣ".�ҝj�m�=: ^�ft��p���m�s7�^�~����͈���x7��gz����.�� ���jvݩ��zj���zj���ڧ�`�;��h�������mng�����b��;��lyaf�f�0ߤb�* 2� �&{�]r��,z��`����&rl"z (@�p�����n0��jv�ڢ2\ozƨx"��?����8��h�� v �@�� �)�����tn0�()t��"�� lp���`g�,�8r �==:>ȣ��7d�he#�*� ��f�1�9z4�b���t�l�ew��e�xjn��)���hjw�ko�.���������&�_f�(b��c�;#�h7�����]g���7��~� ûwؠ� g���u;b�ʂ������i��%��/�=>:d���&8��^�9����!g���6�~p>9n�qd&ؤ�b,��rb��c%*j>�ը�i�'�>)p�r3�4�� �ϝi36�پl{u��%��j�4,�x6�l�9c둯���_�1�����~�ߏ�����(~����/g���jކ�ݖ���j͠ؠb�����b#�fv;�x���t�h�st1�� 2ɇ�<4*n�?���.n��:_g(a'8<�4u8��k1��?c�t4r٨@y¢c��'�j�� �|�~gf�xlm~;��ےq:�i�'1zуltg���p;�1������r/]�zr;e�vz��tg�j���l�x��w^z�;f��l����n߽3|g����e5�2�g����-t1}�dk��y���� �ͧ��x.f��xer$�-6��g3�a�g���(#ܒɔ}<}�c����kz(����ܗ���|o`����{3������t*���ȼf9hy�n4"��q���$e��_p:�ʉo_��~�v|lo��by���a����zj���zj���ڧ�&ǐ#�� ��~���ތ�#?~��[_1�k6������l��k�b�f�o�z�,�ta �f���eʖ?o�5ۯ�hqq�&y \`ǖ9l���݃���/�$pp�e�l?k�9�[(��/�;�@x�����b �'���b���y����ԃ��a�o �l��>��spցy�6-,���2���k�t���.ʲ�!���vrb�:��e g��4�_����ۨ؆�$e��q�i� h�b���:��" �y-��(6,�w�����g�5��f���=i�sfx�2-d� kytqyœ�`v ׂϙ���^�š�d_z¹��o]�^�������ժ?�v�ll��%�ݑ�q�3_�d���]t��7��׿dw�t� 5⒁���-ۛ�i_�]k�wi�b�/������q������8�� ������h�n4� %� w���r��.����!x�`���"p�rh dcj�����.8�csb-a���1��d&�#i-�,�1]s-n{����nu)b�e�����q4��ym���~ \��[email protected],l ^ v(4{�jo^�.�{szw�Ꞵ�������ۨ�n�2&:f�v 9aѣs�֯=��n�����݈��q��������������7���� �k��elzj �a�&�6���xtv�st֡3np�f8f� �gi��[email protected] � ��h�8�2��i��/,f�-���q~`r_8c�9,/�8u�`rⱑ?�d��y�? �-��q&��\�b�������fo2�ytxj� �s�����"��a���p(�e=kب��4�ry��?у" �ѭⱦ3��f�рy.r����c2 ��9�zœ0k�`a��vqֱ��:� &g/ ��@�����:�&s�?r��32'|����d�����:k�7>��9c��0�t8�t�=k oc �ӯ��͛�;lf����`o?������������ ��(7™fxj�ewm���/�hi8��'��i�ˏ&8f�<�f�l� �a��($3�x�g�f2��(8t}>��0al���.f��˧�i���)���n�俣p��j�$y��u���(7iɸ�@� �������i%��g �*y��\�r�ó'�2���bi0 �n硏���\���y2����� �i�<��3:y�iu�e�� ��m$9�dm���:�<���ne�]��ٻ���l�e;���[�ێ�rk-��rk-��r��xelc�g<�����~��۫����yq6 v�у�f�m�f 5i��� �v�ac,h��*�� �/�h�2#ӯf��9k"w�&���6�m��m�9���_��o���"� �#��/x>a� .8x`;j.�p]�`rj�ʲ{|�t��p$b��x���>o�_l�����oi�qe� h����b��/ײ�k�q���1����\ph�o~ⱦ�����dh��`rӳf��°8�[email protected]���8rb��x�-���fe��z���i=<��'ؗ`v2:)ꤢ�ͯ�ha�g�d��fwj�� �l�iq�_r/=�^��o]�������ƃh0���lz�mc�do��n�1�ۇ?e�_yq�is�����,x�b`�j`���m��17?kw���'���i�\�l��:�x$uza�m?�b��q����������4l�"w-�na�>��� �<�`��x���x�uy3�z;��3���ȋe¸��y�2����#��.qx�����ph��'���'�a;m4~��e^���������x�zx��58e�i���l�b|�‚ik:f�dx�b�a���_;睺�� ���e�� �ߍ�v���x0d��g ���;�w[��v'g��:���j7�v��0����'j3�1�����h�q/lo�� ���e��^��؎�4��!ie#�k���w��p���&yf��)0�%� �o�4"��l����dm���y�,�hs#�8j�;jsrޒ }v����p'��ŷ��4rяe!nt 'ۄ3<����v#{�� ,y�����a�� 7y0�h���i�����07����^).�p��$w��h�������slo���n�lo�l/[��ޜ����7n��0%n�f��`?r�����׿}����f8�b�8g�y /9h�ae^e�wa>9�2"�s�/��ofd�<*b�3`�ㄴ�ct“y��1nͅz����9�b��2��*@�d�� |:&?q�i�ύf����xe�q�b���g�h�g �a_��*%���u�@�膩$k�'{�kx&�&)e��z�w|��s6@*����������*^v�5���y��t"�l�l�`u2�ǿn�����l^���������]���0l���rk-��rk-��r��a��i��p/�����w�o�ᛝ?1ח��f�5�ә�%6����ѳa$��l�g/ ��f%���\��i1ٞ����:z0)�0k�y��d~�_t�歍�z�v���:��뾬a����jݓ oj��z�k�u�s�9��r�t�dr���j��il, *�i��e������1���m_tks�˴qn�zޜ��q:м��m"�q��eu���du�ݎ�n�ma�#9a `�#]oxݒ��be���@�v���`��m�%lo4�d�3��5�[4�� ��wv��g_��vp����h^�%�wl�l���e� � 2l��n���6���tʶw6q��� ���̚�i rt�dx��)2� � ���ae�tv�}�}2�agd�;�b� ��%�(n�do�na r/�%bۯ8�w׿��w�wv�~��~ĕuư~�$g�����k�w����xi㏭��v�lq��@k�bu'\2��ϫ����m:g�9���8��7/�">� zg�=�fp�b�8h��v$�?�@�p���3���sg�]t��n�ha�������� �d�!�r𚸊�� ��wȉ� c�r �vђ嗴 �v����t����t2����4��p�j�n��tt66k�nm��q��a on�,_p��<�� .ihl��ɫ�5���2�|',j��ܒ���k����d����v��x�u ��ӄ\��b��0��2cw2��[email protected]�b�϶�bksr.�v��!�8��}�`�[����4��u�<��j�������ۣ�`xw0�3`�����v�\�޾��l��uyv}h)�z�s�e��?��㉄�o�3��c�mv�md�͏l(��~�1!ۆa���?$:���,���s�xe��!�a,�:b˃g����\�6;i~-�_�=��0��#�� ������ :��nh�)5�@bq8���< <������w3~������v�s���eۢn��*�tzb/��m:h�b�������~с-^ 4�_f;p�s�{kp������ˬ]/l/<<��o���ݫz?�9?xln�w����������똉���-�#��0��f4:� s �� �ws�5�[5{5�w3� ƶ��d-m$z�x%�cg) ? ;\�np^�)�b�9�{!�����y�3���<�ٕvb�y���s��w� j r|6(a�<��s~�#]��p���y#��1��kk���wu��l�g�rc����9�'�on|ָ�t���r��g� �/��a�%�s�� ۵�`�,���*.dؿ l#�v�t�����*ylӥv���`�p6Œnk�f��h~���;�j˯�<��`�.y �a�b&���$�%���e�);��l�f��#l�e�]�d_��[�����x�㛃xr� ⧜�jãz{ԏ������os���%�#ټl :��5c1d���p\��׊�k��v�|�my��/��k�j\����z�ծz��5=�d kqzt���,έ�y�'8�|�#����#l��v(��א���jo���*� � t:��n�isi�̯�yhٛ{�������w·_h��y������c��m:c��>m�2�f�l�1��������.z[��w�9r���vi�f��ʛ�z���py�wsz�jwv��mц.�sk݌�4o�ou��nb� zn)��te��a�9��01�� �z�h��i*�c�dok���5*^�� a�"?�w�o-�#o���m���4�0 �/�>�^m��mr�n����� [�6z��w{��qj�v��c�ǜ͓k�x���w��~�υy�sl,���5̫an=�ۥ$q�x�ov"]2�]����g�8l�� ᜗?�g��l���fo���tֶ��wk�z=�5i�a�վ��)8~� ��|_6{���ծvq��f8ob�r��w{�v�`w�f�)���f���ll?ҽ�x=<���&�!�x 2�]2����3��?��ԟ�pf{-a��|w8��puկ����kzwy���g^��ީv�蹫s綁�3&�y�l�������wi�ɇtj�r ����w*����gv��>a� vܝq�l�4ȭ̹tx�k��'w�δ���ή�sn�8=�0�n�j���*λt�!q#y�d-��n�n�ˬvf_�d�fx�~mz�:����� �ʭ-qu#ow��w�����\��^ ;��r��!��c!����gl8hx�����"�=!lb�k�����u����[*2"|���˄��q�l>q�|�n�ջs{��w��.ra!�m ���*��7���f zk� ��r�>=��av���9�:���=l;ʡʇ�dkl���'��văȭ��ja�'}l���g��rl���<�7��tx�.��fo � >��yh�/��*-�r�wa_� ��ʊ�{� ���8<"�[��r�:|㬄< �>�� �q/��ףl��{9�>~/.u�;ʨ�/��t.��t��`pl� t�t���-&�}���e.�c�6/s�� �``����~�b�[ |� ��8d?���p�𯆰t��ӂ ������q���7�߾��{�~����0�.����"�(��"�(��"������:�^�����/~��_�x����n��>�:h� � "�-��c[�s3������s��f�tg���@k �ȉi^u�ct���@ ~.`;q��j���n�� �p>���q���b�l�{�i�_���u��v놕�a98�r��k(��y� �3�ku��0[�x��4=-���ڞ��u)����}�2�t���p� g�h� p� �����l��l��k2:f/�;�!a[@��j�"�_h!vrh ���=c⮡��k.��n\ br5! w������p��p�����gj��3Ϳyo������=�sr't7��y|�v���� �o�n1�5���_��}�4<�<������!u�p�3ta!�f�rl���.��:�w!�ӂ��� �p�m��2tp� c(w���` #b� �d�-�{e�w ӽ�����h�6��i���2&��p�7=l���0c��w� �_�}����[a�7� ߽�� ����f9_����0�����o_>��_a�p���a����z�~�p�"��:�qf�v���2(�?�[�:��v 2��b����ƿÿ*�,?�8;x�9te)m�ʜ��!����i�.�180&tx�[�k�i�5��z$��t�b �ѕtm�eg��'5qh��-x��ǃ��-�j�x�w)�<�s�3t��@l�,r�h fp&����ru��r��|,�?s�_��_i4oe�� [���py�>a���ϰy�0&�p1��c��f(\�r�wr�w �k%�dh#k\h�ϵ�l���� #��!���pxl�!�up����d�/1� ���v,_k2 ���<�� řg�s�����a����w���炛z���"m _�� ��� �u�|�z�\��kq����,��ݿ~�����b������{���/�}u��f�����y��k��j�<�5�f�6���s�����`����ڏh�'7 �w�ؽ%=nf��c�a&!tthmr�[z�zl�!d\ne�n���p�jb����d��l�x"�=l����rj�_*�o%t~s �z��4tk�`|,3?�3<^�,k��i0&d����81lsq���qy�_x|��į n��x���`�@限�'�t j�g��'q��p� z��yrp�i��'��å���a�fx�6\��2�2��y%0*��2�w ��v�=���4� ��:�؀��x �p�~ �w�to�@�;hvo��3��tv vvֹ�\dj��� .���ohdf���h�n��s�۟�x��o�̿.2}���j���j�\�<�be�p��q���ꮯ宯�0 �!�>@e]�/q}�@�@��?�a�ؑ��y1�g�ꐪ��p��ڽbz�ק����ʐ��\8�~�/�?�}�������r=�1t�����o�ph @�[email protected]�� ����,!�8�ykhxap|6$=�w :��t~���x�-������;���]��n�s�e$�f?��6������,2!�� 2�!��,�\ �� j�[lt�-(ӆ�!rde�6�#ժ�\e�[��u!t�ln>��� b#u����"e&�gch�@ �ia;�7"b�w��9��^%�w��j�sf���2x0z8z�i$9p��.�� ��7�p=��<��wp�(ǘ�s��|x�i,o�a�>���8�1zp d�f��#y�o�/�@��\=3�a��� o�a��㰕؄p����p}�>{��'��c}߿xi�y��>��_m��g�eqdeqde��?��k`��_��"�����#�� �y�i!hfr�w�[n����'�/nyo��h�|ex�2s����>�}�j�ޏ�o�?���k�9���z'.��p?ä��|#y` �z�e���� 9z�w�:��5~� α�ym��j�ą���f�vtbgev��$8�~����ܓ��<�^^�k���i����yq�c���1� dp��r0>�\ η��l�(6�y���w����'���:j ����9lt���6w��>��/�쾕��f��[��/8p���-����ҋv[�j���殁�*}h�d�@k��1՟��wy-w�'�sn�❺-n���<�ƕ!�tԅ��n1t�ܔ��":����{�c�k�?�݀%�cl���a��b��x%�)�e 7�!�������i����]w> z~c�����$xf��'�z�݂���1�~z�t-���5'?�9t-w���> >t�s�#����'?���9�1�����h� ���56�  ��`c(� ��� 8q�o ��ƈ<�]���@�@�!�ۇʛ�z� 6�e�a� ����<�n�恻����� f�-���v� ����:� ��|b�[nc�n�ʂi�o�\g���y���[e-}b�@����#1�@}\�[`���8p ����?�4] =|���&��ǥ'n�=�v�k%y���rs� ��z/ 9��#t ar�}n�g ��l�!���(��g���xg��$�e���اn��~�q��}�2\c���s����js���m1�7� �hd7i��d�zd����d�w�1��ðar��]�7���/����?�x{�ϊ���a� awx�nۊ� ��0�b�wj�v�#3#2-!�.�"2�w��:|t7~�@��;eg?)9�qɱ%ǯ��}ly������`m��y���_e���s�� �l�i�>t��yz����h����p�� ���j.������}��`��w裕g��:u��pw��6dn�j�[email protected].ѐ�����[ym�2o\]y�jnӭ|���-k�`��b�@x�kp��:p�q��*��z�e�/�'�z�t�q���d�x)�� b�a��w�ettc"�s�y� ō�3�}�o�bd��@r�fl!"�=��7��":���"�@��s��2�� �"l !�p��;��.�� @�g�|wv�:��*�� f�'%m�9d����h�c��o��_�<����v\v��o�o�v��p ���$��oye�~��c3��ʺ�˅�w�wy�2o\)=�1��ǣ�w�>��,?qk��_a�wc���b*�\�����'�# �4��z?` �r}�tk�1>�ɭ��hln6���h���qa ��y?��f�r�o�i����n�"��a�=pfa� *�@� qr���@�< ��ഡ\*rbr�g��ۼ2/q�cb�-�p9��ѡ�&?�ږ��9� e�o�����uᑛ���c�k��rt�jѿ˅�n0��b����z_nfj��fv"uө ne`c�o  ������)�������ނ�іo�(��"�(��"�(��~�o��yf���� � bdԁqk �~��1���t�w�p!�g�*.�9}v�؄���kcf-�4;}rj���e�s3'ly5meԍ�1iyq霸��� սu���ѝf���w��r���l�@bكm�ܬک�/,�9gդ�'n_5�(.oתc�l�y�y� !�`���,'ɲ>7� m�i[3eڲ��5�x�vvn�;��,��)�zy���\;(�� a������z.v�y"o�j�rykoޮsefo�spf��eu� ��� ��u_v�7�dkrza�ԍ��w�i̋]�9s����c�ս�:p��v�������d�;���2ko�ba��%1)�щkc��bg����zv�[���!�j��%w���fm� ~b���1�3��rbru 6����`h<�`&jl�j�c�[email protected]�8�`�a� 0a�o���zӿ���ü]꺻���&ta�e&�o"x��a�[��җf�o�z6?jт�yqɫ�sbf��n\��rb��i��bqb�屼ݳw��n6a5�>!��"-1��z�g ex��6�=w�ؔw�q����������{ 6�ކ�@��^� ����;�o�y-�={q���cg��lϊ^x���s �������n��� w�k}"�x��p�<9>3zڲ脜�k���4��c�}�`�;�7�v� 7���^ x�/�~�m9�^����%��/���$6ie� ��jg�it��ѷ��2u�k� �\uσ���cv�bgv�<�düz���ȼ�b�2�_�0.���g��q�g�^219=&mi��eqi�cҗǧ-�o]�:3}ּ�s�{26����m~��l(d��t�� j-!�l�o�z����w��2���r � �{�oh���������_ǎ�� ��� ���� o����!�lk����wf�r&1cb!ԓ|u��%�(������[email protected]�mt�y�`��i��2bs��%��kz������,*!c\Šqɫ���g�(�-�n�j�ua�:� "ar��'�!�d��@�ug�/�{�6li%%6le�ny[u{jݺ���k'l}��i��%�}|�#e��[�g>oh� ���ώ��l|b愔���Ԥֶ�v �yx�����v�*@\bf�vv!>k�n?�.of e� di�c �?�4z�@��π��_� � r���!~'qݨکy� ���jb�����qkj��]�s���f�d8� q��!�6l�c% t�o��úʣ�yf�y{?\�����[email protected]���7_*�?�`����q)�b����n�idc[��-3�eo�� �/�������a���߼�������[g�����<&�e���zc���/20 ��� ��h)����we �� w�.`�$-�j^��<693�*�yqiٱ ٱӳ'�ȍ{]��{�f �����> ^md8/[���$吟z����'�_h��o!e�p>�v(�q��/ї 5���di ��uơ�zk��ic�v�d� q �b� �tڽ���!r�6����l$`�ez�[email protected]���z3��֐�̄āf� |_#�\��!�)h�2���w��z�fs�gflhx��$.y�ĥ���uq�t"ʌ��ө�>6�=1[��lx��zg}{���&�zԮ�c�ql(߂���#㼝o�_���&o�.��#�(��"�(��"��opo�>����@�lb��b�҄j���y�gl�(:��.�c�8�����nm�06v�q#�f���2y漄y�ӗ��z���>}��)s2��ff�-\\����vw�ӎ-x��q����= i"ef��mҟumݿ����d�̹i)sbf'�j*�]���|�dž�xi!����b2,xi��u�9���͙4e�����)k�� ������#�ڋ�7�'k5!�1�o������������ϋ�^21s���p�vt �l>� � �w���z���ŗ��oh_/r��_����lty�;0� ͇����"�[email protected]�ё��%&n;rdx�o�f�l7w�t�b�x��#����dݟ��9 j��d�n�3>i��eii �f�dl��u^�fk-c[@r#�1�w��j����嚂%�{ b��_��nni�~_��p ���'��f�g �z ��2�b��5k�/ij|}\l�ȑqq��r��s�%��ll�l���8w��y�r����.�ds���2���¤n�؊2�h�&��>��^u�e����(5sҩ�����r�����nd��wa��ͫ���.���sf��;.��/[5e���)ii�fg���@z������wל�wv����[email protected]���k-��-��j�y�� ���jf e\��n���9���mw�5�;�d]�{eu��?bz%�x�"7u���s��gm�hš}k>�xlpw�pyk��&s �љi:�c��o�*�׮�y}ּ�ee)�f��w����,���9��ʭ��r��ø�xŕ�#fq�e�=�҈��1b����n^[�r��|�oe� -(��eb�du$�� �$ogk�'��|}�����o��������x;etv�����ůh���v�$rl��t8�i��mph�� ��9]>ѹ����{�(wsj���鳧em32j�k_��:5y^r�”���3�$�ʈ_�r��e����(��� �za˩/} 0*u ���뎲���e�h� �r jl}��iݛ\�8c���e�f�&�y>kr<���k{$?�x�o��|��7�f&&̟�0gzڢ�9k�w��v��v� vw����ݮ7�2˄�a���emּѹ���z��ؑb-1b�&j��ø��w��eo����5c �p�6�֑|&�al#��� ���a�y���b|�� ��|������a�1ij �$�����fϙ�>m��qcf��0:*!6~eiik�r�&$g$$gooξ4{i���y*k�����դz���8���v��k���?�������힂�p}��gqdeqdeqd?�?��w������d"rqb>� �i�vx�����v���۽*�@��^9ts�o�fs��1f��lr�z��w�bom7�٨�>��󲦌�8:*6jɗi��sj�)lck����a�[email protected]�kw��]gן�˜��u�޳�q��&ydʄļ4����v9� �g�l��7wp�mk̈���$�\��=����w�\��p�t]nʴ��y�ye�ɭmc5�a��1�#�l����:qyzԤicfp)19�y���m���"�6�e\"��8�w���jo&��j�[email protected]�m�xx���l�� �mi��[�n�~k��ú���|�]������c�k�����z��)�ss���xy�;�n��b~����xr�jq����u�)3ƍ�0ⵔ�3����o�;}u��j��̅�9}e�{"�ge�m˶���նbg���ݥ6nx/_5va�kk'em�9����񬯢[email protected]���o��.bn��hb�t�nm���f�g�l7�m-)�l�5&1kz��d�í���d��ͱ\�8�j�p"uwk��s��܉ƶm��eѳg���p߂�om�5��lmp�#t���?�֟��͍m�3~��)g��j��d7^ޮ��e � ��hм��q4^�fo�0cި��ǝ?���1q��č3q�ؘ񯍍12&.5iyl���n 6��� ��@�e"yz��%4 "4o�9�_��y;�����ӥ���?��v ��m���(se��կ��- �r����u$w`k,y ��oљ��}2�cx��x�|w��s�ek�^�:2q� �6�x��b�����3����ae������l1>e��”�7�v����n��կ輯:s��|�yl��,k�s�0�yț>m^���)���m'u��#��c���u�t���ay��y &�ώw�^�h��]�mz��ю:���ik'e���o�cq�v��/��������m篊�2�r�� q�7d�ީ;��c�ot ��u�@� �>c�8�.`ħ���ܹ����pz�1��[�8a]�����f���;�,��c ��n���pti��[g%�(�`1��dr�@�4a�� l�@q�s��$�03�83����o���޷u�z�ޭ��7s�5���w[��ڝ�[5sۿ��)���s��������sfr����2��9di肰��������k���v��~�1�κ��fy��^�~�ؙ��b�ވu���/�ݲ��1�8{��2:z'g7�~j0x���� �0mn��au� ���a��]���@��e��hvgxy�5gc�������������m��:nq[��'�/؆x�y��� ���g?��}�4g�bha� � �l��!wq;� dj�\-���� ��k�e��p�:=�ҙb� ��ͻ�[email protected]�x#�ԁh%�r�p�g�z�d,���k]y7i���.�&v�x)�w�pf���u�j�x�l�c�y�j7e��\�@�rz��.t;p���`����؆oئ�b���zv�.24vi!��ury�iy�x����w� u��,���g-]�82zc��:aj���x!z�����e{з�ٷ3���a� $h� a��[�����j�n��d �tn���r��.u�\)*���'��4��l��:�c���^�����iil���-�� �?9y��v:y�~x|���༵��o�ɣ�e�d4"f��o{r���t^��g=��`�s{1�m�[}����&/ǔ�e&d�&��5n��j|�0��f'y��h�4������ ;����g{\��]m=o��w�j�w�e�cw�g�-�3��l� ��!���!>w��ؚ�t͢��e9��v������m0��e����0�{� ����n�ߧ\k�y�tw*h��bwe.l�h�����q������u��,sy�ժ������goig'�.ܐt���2���n{&[email protected]�,�3.�ark6�l[� �~&��{�}�����azmɔ�e������coy:h� �g�*��"����`dn�,�;�z'%�_t�����?׷� w����}�$h�^'���� ���k-���uaq�"��m��5ק��=-c`s߫� ט��;��"cc��i�ekm���&�����f��@����\�����_�b�␍a;h�%��� �<��e�]�@��r|do�<�f��} =��������v�coȉc�[���i�����c�� ��v1�hll�˜�xf3���6|�����f��u�56qadzhaǟ��e�gj��2��ul[�zu�<��(q�y�c�t𣓵' ��,elg�b��r�~�4m�ay�8�����p�i�iv�ǭ[�8r��u�eg�(m j�l r50��km�kr~%"�$|g���¸@��ħ��j�ƥoiܵ-r���ik 5x���<]���fgpz��� �&�r�!�rg^h������~~����?����o����`��@p�[�bb�b(`� �ϟc�d��(w0>���t h�8�i��!����b/c���-l(y/��w^wy�\��l�ds�'�ϙ����"�d!�^����)rڞ�͠�ly��c�q�`xr��f�6#]��xs~x�hc���ɓ��;g&.8jo�c���jn2qu��,��^r߫��\�����ؿos���\�h'&��t�j��q,�3d>}3�ڼ6��}wԋe��n۽/yr�hժ��n�y2�ێ1��/u���ܺ!r����z��듷]���h�>���`�z� f{i�g ����'������j�����sdmɛs�/e,�z�g����b� ��g�{y]6v�pf�tc�zk� ��ˆ���n�coόd$"ֳ�u ���n��p�e���o�s}�?� }w��-�2e7n��n� �) ��ŗ�xrh��:�j�_3�m83d�b&gm��q��aa~}��l�uω����1�����,@d"���$�`�s��o�j��o���n��ms�%@vb �����*;�0i���b�^��v�ew��_���ȼ�nx$yj �:*u�(%�va�ֺ(��:�c!��机ŕ�;u~�z.0�;�h�ѹ�].b���k�s�j{`���\t�|�]2���gu˜ βk��q����r������󘸝qq�v��íׁ�|篂gf�=s��r%'��ee-�z�x�x����d‰�<������ �w����=�ۃ $h� a� �����v��i39hf;u�u0q�(�]�r�tp�,�ah �ҁ5�[email protected]�n�������� a�k���_$k?x}b���w�^�ɋrg_�.�cxk"�.bd�l�ɨh������l��s���jv4��g�n�b5�w}%��-:faqҳ��w�c}t(��f��]������qi������&��ži��n�:)��i����ίέ^nmk����$�ӕg���.��f��� �#k �^6�3~u��)g�r7[�e���&t):q�{k"c�ۊ�hբo<�r� ���a����&� ��֭�n8����ef����z �\�gb�2l�p4o�go���׿��m�v�,��t��(�9�~�h��)\x�q��*\ծ�v��[���`�1�*.���5>��>��i �q��@$u�u�,m�up��i�����۠���p��$fhr���{�?k�|�l�nb�jp�a)�prfvdzi���� �����j�h�������xu�bqq����1���7�f�6ck�����u< ���뷝� � <�q7k|���q�hx��{�������!��{�p�d_2� -���a}���c#�o�{l��k���� d��d�f1�5��yk?r�(�rk������2�.\x����y̘s�]b~�%���[�@ �� %��j�(���:=�ni>kҿ����}ұ���a�3����a����^�c�e����"�;����*��|�v�[��g_��^��m�:�o*ni)���ٜ��}�]��]� dvn�� q`�;�cn�����z<����-��� �@�>��g�{ �e��vziz7:c���;s�$�em�!w��i�f�ex]t3l4��7y�a��*,?�&>-��bd'ɨ;z�v!�0�.�20���uз $h� a� �����?�e�}�p9�&���$��o�����d�b\��k�r !� ��}ip= )�_�mib�va��#���p{pjj�e�=��~�>�ч�c�vfƽ�b�&��p|������e��n �_�vqkru_z�j�] �l<<&%n��zԑgŝ�2us�� ��ʋz��x�7��mɇ~���av�f]�z�l�p7��dʩu��=�^3now���9���y kԇ���d�89��,bsd:5��[ ��ճ�n/��[�[email protected]����5�s<(��f���r3��,e/�amٴzqrq���b�[`p�5��%����ϧv$���`pi m�ǣ��ƻ�;x���o��}�n�m/k��� g�d��^�dxy�na��֯i}ӝ>��u8w,v� ,�خ���:���u��ݓ\�g󚥷�m �� };]0���n��o�.���pc��;c"r�9����2)���l�l6��q�|�4� �8�n���7g/ y�x��6�>ok�� �vz��`����w�k9��1�[bw�4vќ�3�}�n7r?��8h�g��{�&��*���j��n3k�|�k�.�^'�$y��6��:�<�o�/}h9ؼ>>�`ǂ�u���_�z70]ov���.��3�����ⱦ��6��e�j�s֙��摔 /����m����[iu#v�b�m�rq���n>a�;]� ta�~?�� �� �%�ɑ�{��[1u���@�8d���觸g��h���}x0<ǿ��x|�}w�y�k�5/c��s����#�ҏ�.0��,s8�et� p�b��(w8 �x 0es�'���?~�g���?��������wy�mr�#�@�)휗�g� ip^��kyi� j�d50�*��s�o���o�)� ��"�:��y���xe��c��1͹�a(�8�_�{�k$�m�b,y��"�9���@�n���\t�s�qen:a��٘mg,�c_qo���k������j`����bu_�n�rr���7m��k7�k��^��x�/о�kg�g�e1o��-:fdh?'�\(} @�bvc�ͼ{�2�0���n�.d򾕒��sb $���n�m��pf�f4l^�\a[�-g6�>ti�@�[��k��)��������i ���\z�g�o�5���k� ?�k�9�!i��s6�kz�v/k�ѫ��i�� vu�/*���g�/=e��nw鈛r�j��._��ؔ�x�z�o�l��h�$i�4��dx_�� �����g����5q�5��f�sl���u:�2�.ss���c4�l���׳�*6-����a�o�@�o�{<{��{��� ��iٶn��@\�>�y♰�-��unst_ql�����1�%��,gh�g��k1�� �`�_h�ci�b:��j��/����[��kv�[�9l�,^��β!��6��iojits��a��ܱ�o��}l=�28 z�u'�.,��_yg�|�/ys6�r�)sl�"�5x�&/�� ���c��130��~��_�$!|sή�6���9�4m3�h:^�t���]<�yu����� ���lku�q�_�z=\������߶��4mkdn�;$ѩ<,9e�)��l�"w~�p��#�|��۰6j ��fl�4t�?�ӽb��ܻ`ݽ��>����s��q:��7�k>�em q�]�!�p�jf eų��,z���r���.��vbg`k ��@���b�ol��o����5���5�9�y�1�� �<���$�v: k-[��-\�x�`�� s�q՝�w)ڧ�n���|��a�� ��> ���:"r�"�ٍw>�[@��_��y~1a�dqfcی<�y��o�f�f8�)��fq;yz�eprur 4���wu��|� v���o������_u߮�j����3m� at^꘿��#i�m;�"��-[�=�������n��o�{c�ŵ=j�g�o ۍlkt05ox=0�ƛ�������s<�t��4�j,��>/�&�? �s�� �e�h�r��)��x�y��g���t�#~{�bdbe�:�iq�������!ׁqwm�k��~q��ڏ��'�|,p���t��n9�na��?j�~h?sy7a�l7#�xr|��4�fqש� �*�h��xqcg�����-;��� �]���)k t�]�&'�`g�ml�����l\��mq����n���$\� }�:uzn���}ٵ&���4k0l4jm/�:�tn ��p� @� ��lh3ȶ}7����5�n����������?�������������ٷ�������?�v���wf�y_��4���h�5;y�5n��a�9hzhp��)䱷�܂x� �)so=��{���cryijx���@�[άkw[h�kweryq$�@�l� fl�ͽ���e��iʼnu -}���y�f�znb.}b�litp�")�eڹ�s�q�����w-x/$��h_��%]-���9��ǘ?���9��:9l��v a�n��k��� j�o� t�bԛ����m���o�����!��i�j/�ٍ��y����5_���k�"j��/�ihlҋ��;�?ls������� څ��e�izs�q�����k"�d�376����ej�s�-����t6����q�gܔ1p`~�?*߉/ˤgq��[�o��ny�4�{�ƕ���>i��&|���};�/};�z�]з�߮�s,���3s'�� � �ʝ�)���2�f��3��9r����p�.ab��� �#���� ,� o�wa�%-. m{"|eth遤�gd�_�v��l��g�5�ҏ �=9�}f4��~ɕw,%,q�%}p��d�������g��/1 ]�`����t yh�����/j��y���k�ӷ�ɇ6�o~oi ">{9�d��≻��'��:��l�4���b[���0-��s�em����<��zᮖ;�*�����ir7c�ck� �;���;�j;�o _�kg�-5�d�w~�e *g�܆�s�{�wa��r�v� wdve�����r���a�f�㝠o�ijb��w����o�*��u}{� a� $h� a��_�������}�����.�bޗrt�8��~��yy�3˜��������k�#�se��ptn���4xife�5�r�q��d���3v-d �� �i���j�avy�v�ku�@έ���qy�#�d�s\��h�z�b9s����^ycr�(����tqnk|vb9be��,vv��r�o�~���m����:��ܶ��so /�q:�k�e�iz������n;��`q2~u�y ds�d9��� � �,�]�q��3"� ��fu���2��34�~w� �ބ=��qop��Ԯ7l�����}�fi��ib�l"v�{��դ���"��!p�u��\��a��w��ùq�� v!vs���o�^4��p��br� im;�o3;�ר��z����z��rr�;����s� ���c�. [email protected]��c�v����d]���a˲ig�?.s���<�������}�'��v��sp�u��#�/n��{�������n��m���}nt��i��ȉ��]��4,�n@������r��ppt ��{`�t3f�3�=n�"�ϭl$��=�gn��"ws���/���ٲc/c�5��u�;��s�#c�w����q�i����m����s� �� ��7��]^v/�sh��5��5�f��n/��k�u�c�xv��k�>��j ���o��������}e���x����<��!ˍ0�� ����fp��v��!ԃ<��5j3e�"�p��&�� ;�����=>��l��.�ƨ�(���z���xr�'w  o�dsh3��}7����y�����������?~���ww��s�4�z��۵0m�k]t}��ty�ia�=�n�@���y�j\8v��y��w���pɼ�(;�w�y������ ����2dh���6|����&��<.=cؼ��}i2-yt�>�y |?�������i�s�w6�}b�t��mn���&�ex�p7h��h�s�u ��2$���lp\|\q�ɵ�^�� ���xr~kp!=��v�a?���-���ojzges�ʏu��������љ��ۚ���[email protected]������o��gu���2�h|b��[���n)5�e ��;���g��֦���#�jb�>��_i��5f32o� 6�^�stl�:n�v�� m۱ho�4���0 -��������l��p<rb/��qx�g�oz�p��v�wm�k� ��������9���} ��ds�t���� :|���݁8p���!�n7� v���tv�5p� ]���jj�j[0e�dg�h)r=vi�_�ʻwm����/`�& l�ir�(��&��@�8���y��s��keb\�n7��}u���&_�� af�j��܇�����t`���}��< { o~|b��9�o�6�<3fe��?al^�s�%���k�j{����6��� -���3f�ls�!���u��a.?)���f֋t-1sб>q��x�iy��aͬ)gn�bn� �ͼ�v��-2��ʱ'y�.v.���������qt�ڀ�4��$k���zae�t�쥏�r�ҋ���"'?�����w:"�)c�{� ���zس:��u�i��j5�3%4%�5�#eo&��rh���)�ʊ�sgnھ�%w7 �ib} �m�p�-���� } ���}���ҍbxz� �5�/[o����,=�ӿ�jl�˚���i���f/wsu�����|��[�`�f%���i�vy�����,��%�� ���y?��ꙏ��0$��kjғ�&��3�cۘ�uu3�k��c�phtqj�.�<�؎��7�w�t��5�#/�� �'5m�٥�ξ�s�ۙ�.���_:=r�]���o�6ke ��^��29z���� �f����}� ��/?2# ��9��n�*�d�^w�o��*�x]1�]�݄�,���� ?��n�'$���ztp3<�m�r^��v�j�,�֋��ekl��.2�ms-���4�wm���j����*��ݮy#���rօ" \ �f�x�'�х�:��%���zԕ�d�׿\��7o���|���z�����?}��o������ۅා�j a�v���f_ :��^�a�ԉ� 2 ib! ���,ײ��t^�tۈo�hb�^�bȱg�bk�l�baȝ��_t�w�s/=e\^g]t���d��rmv$�f�Ž^��y��|��}w���x�����yy��1����>��y-]k]s�z��*�?˝0���g8��� �n�{ld���;q�����ώ���3ۄ��(�k�t�(�p� e�!�4x��:�n��ف��&|nbh�{ ;����o���ez`s&��=�;u){����!����0��c���y3���u6og`�b�=��>�ky�,d�v˂�ku���l �t\���[żgķ���to�]@1��j�x�)�bp�աm��k*ό����,w���e���d������)b�a��crkis��6md��m���xa�o��'�b#ch` @og���<�vi$ b�e(�h�3��s芾z�9}����㗞�t]�&!.ۮѵ�ն`j��ԍ_!a�2}����ԑ��\��j���utd�i��(��甦�-nn/�ȁgu��5.������=w�l ��p�0i�ܦ���hg����9�n�n������ ����7�a��ɨ���x�y����s���q��hɭ6ɍ��c幸��ȍȥ���䘀@���–������9�v��8�>��q���kt�u�&ɵ�s�er��� ߘ�r=r`�)0� �i\�g[, aa�iud��,31x����m��݀sb�a�}�n�b��r�㙎÷;p���8p��/��̷����۵���z�d͐�3d�ڷ l��_vrrm����ϫ=m�1ma�ʍ$�� �_����5ܟ„�pgot�����^��i��� ��gd���܄j �oes�ťf� ���꒴#�%���a��i� ֤�1�ez��z���~>��������gtzt.%q<��"b� }a�aq�>c���/�jw� ��e *m��}c�д�]�>ޮ@�d�`8�.��q�c�h��zڜ��|a=��$6e��:�}_!06$]t�g�!��!�⅗�js�x���19 il 3�#6c%�@����1�a1�;���wg%as��)n�e �u��v����ו㛐 3�c��k[����mg&���.t/�l?�?ia),�=\���k m�d�,u7i���prqacx| ;��v��y�j? q>�[�� ��l�c*���iq"-m���o};��������������_����|���k�n�c������ez�� �8�� 6��zok���>�t]]a6���]-��v��]j�p�f��k�� ��3��z��5���􊃞�{��6��r�ʽn��ww�vdy���7�;���wvv�{�d�d�(��< ;���u��|��|�!�wq\������1q{���0�q\�b��#��6a� ��s�ȋ)"�,�ŷժ��}���v��zǻz{f}��y��iy`�f�ҧ��u�yv�^>���c&gpb�p�t��gt�yf->?,�3�g[�=�a�l�����3����m� ?g�⛇�2}v���×a�m�p�1i%�mf�i�z$�rtjo!<|o�w���n����j��-��䂌q~�b�x���&��o���o��[�n�>��÷���ݶnib��|=�r� �gd���v�!w�u/j�u��5�f���"j�jnj �cbx���y��]�����hֹ��@7_��刜��0ɳ��s�%1=������!z�`s��zjku>&)w~տ�38[��w���k� �/��ct)�{f�xs���r� _�h�̚�n.v�)��޻x�jko� v�l ������6�՟��!��q`�k� ��v��mb�?\_ۈۛ���*�*���5w����u�b� _� �t�����_v�������t��hr=��*khj�� �[�.7p�4�"7��?�=�)�� v����&�>f�[k�f�÷ƿ��������� �[�;|�8p����ȟ���u��i��o���o���2:�y>u�����s{���ǚ�ryh"-n�� ��-��p�:t���� %,t��k$�3�}|�({�zؤάw���n�(�f��dd�p��rv����2���;b%z򒆽�ms�m{gi$����&���p � }�:�9�����m�b��_�k���_�,�q�⢆4�� \�e��}�����jŏ�*k��r[e m�aٮq��s���09���=�y^^�g�g:&�1�;�yє= bf�h�7rλ�x:�3�/>��o��`"’��<����q���v��~fk[x�]xz]�{k���,>�x�/�e7�r��jt�����sz�$��so��q" n���p5b��������:��};߀7�@�%s�'�t���ַ� �a�f�:�� �؄�h�o��i�� t�д}�{�kxq&e�q�n��l�n�t&�����ao�w����r���'s�ѥf��d�8��5�ʬ���@�>�n�ŕ��r�q�a�q�@�s,*�0�w�j��f��i4dh�32o���ďa(�6eo����[�� ����~����k��.�f��x�)sv���[email protected]ܩ���t5dgw'ey����rk���d�]� ��mn '_aʒ��-��*���my���߃ih��s)i�{l�mu(�l�)���si [email protected]�xg�q���l�m��j9�_n�8sb�8��3kbk�h��0�e�$y�k����67�=e`���*�����~�?���}��|m��_��7_����~���7��z���o��g��z�o��l�e[dbvd��x�|��uvaod"��y#���[`ꔚ�*cټ���ϯq��k���u×�!�w�n�ޙ��~e��g������w�숡�����l'o���� ����鞸�̳�j�53f�ș~�<=��=��[�l[�� ���]՟r�������v_��2$� t��9�^�޽��q6>?!,�#�_w����$w�g�(�@��ĕ��g`�y��r܊�%u}h�t �����_~t��g00�qa� �@֕�ik��]f�dn��������_2&�0��ni ���!%����l�آo��\3�oej�p��҃��jvx&�?a�n�pg�p�th$uz��6���ce�p��ho���xg��o!���:�@g��h�г�� k� bl�p-e��ϭc.�w����kk��aiq�q��)�� ��^��l����g��y�ȇ�3�;�#�p��cj�l�'� �{�;jo>f�5t�f���=���zy�����j��dg�=�tw�ъ���u�;??:�1ښ��58�і<� ��/.l5αĝ�ġbx�; �-�՟��uf�>�� �~��3e����l��gp��� $ލ����ܗ��x�t�d�:i�����=k�͚p�~^3o�h� it '�#߭[�$�j�&��@�b=qd����’ޭ;~�������r6��>�ɒo2ez�÷;��8p���8p���ʒk2 ]��ktt�#[email protected]6�9w����������s��6si��}�'�`dz�؀plu ��箔7���������������/�� ψ�����e�ٍé ;��w������=�����„�&�1�kk�ܓ��գ�[y�9�@�x'�� ��b�b2��q��)-[�]ǵ]�n��yx�,��w�� lx5 �� =�h<��-0� .7`f��i q���4��f�9���ney�pnukb\���7��g�b\�u��x�ft��h‚��h��di���~l���a|�>[lu�< ��'>h�k�fu��u�ŧ-w����8<���`���|�\��8=됌!�|��0c`��4������jz�sz,w��a�vc���]�:~���g��?a ���f[be��3�ʋ����_���>����v -�$�4�m[h� � $�h(5d� 8�ᛸ3���#m<�s7< ��:�t��6�����5��~��{�}s%�<�`fd�?�x�y�������ʸf4߄��� a�!j��?Ÿvv�[��\��pr� ��h��?r:p�qf��z��l� 7�5�#ؑ����fobr����0�d�k�i;�d侬�lbx�j�)0כw>���a%&����d�=fr�z��f�/� e&�؂�p��a|3�o�)- �ꮣ���f���a���4�z�=a�x� o�dm�� k� bq`�{�-i0�u�jou��{�n�ۯ���o���w_���{������7���׏~�]ڪ��{ߎ��v�_��w��ڷw m�j#~vw3�gn��u�rm�6/�7����z|�]^��%�����=�pay�y��g�t�dq��3�]�4ke���a��w���������<r�:ڌ�u^�r}j_�n�,d�ت���~n���!e>i�a��j��n��y�g�4h��(71�a�̋��>�rn���ňf����wj�4���yv��\�h���g�2��\��%u|h����r-颎t�!k:mg�rb�v�����l5�o\�4��%�gwh�m�5��i�kxg��&�%��a{^���nyi�xb ln�p��k��!����gs)m������|�<2��,s�i=e"n�l��w�?��v�o��q��m�=��7 y��\)4��;��%�ptj�%�:h:_vaoܝ��w���o��ŗf��d9ɀw�kiwd�*�ݹr��.��"dg(�ėe��ec�2�{��#�#�o�-(�<�(����-wq�(�xm�ё���qǿ�&�e$�d'�d�& �a���qz����� �kl�*@��-agڿ��m��>d�1#\c�h�w��p�����y��gg��9�^ny�w��i��i��w���xc�4�im㴞5c ϛ��?��7�}{��������bud$� ����z��@��j�wx�o���sb\\�2�!�񽏐s[u��zg�÷;p���8p����?��?���v��}�xk��x�~�u��bhk�w|`l~�q�c��l�h����a�� ��ʗur lx��ajm���� �0�k>���f��l�yoz~t������ys��d��_ �w'��w�\�jqz� ̨�%ۨ_42σ�eagz��u�k�h1��4�7 4v;��jc��}g��u2k�tks�.�u_ז}���]��c��� �v�n�?g�6q f�e�jk�4p�.�ufd�o4^��eѵ��!��xqz����8v�u�����f��:��s��a�&i��imٌ��q���=��f�s���層x�s��k�а��ο�j<�v��.�2���u]��;1�5(,�,�~2�w"ף�o7�=�dh�la���q�v��ž]�7��d���}��ӣ�l8���ll}���3m��o{�о�;�1k7�j�2t �({���2��vu�����kאͽ�)�s�kly>��9��cb%k,���nk��k9�*�����u=<�ؓڑwđw�il���hj浈y |f�8�'�l0w~ڸ�w��~�����8� �vo!\�r���t�h���$]8���[email protected]z�{p��!ݤ��t��$4��f��f��6㺥n��ni2����%0���v��!��!��ݪ��\c �/�7�~��ߋjl ��*�;�����sx;d�:�� 1�6 x�r���c�ly�9h��a���� ,���a��6��t��,�% q����t��)�2$vӎ��֣-o���ժ����o������7��w|�o���v�r7��&��j���=���ȴ��՝wvj� @(ګz9��gl�6ruj�l��j�re���76]xc�^(�`�^�(��8��>�>� ���tň��>alyhsۤ��q?#i���j�'����ŧw����j����%���z��|��� i�g6'c2]"|bбd��gd�/�%&��hs��em�>띞b�b#c�2��� ins��s& �p>g�][email protected]��e���k���}2s��.�hw6��x���`�x�n� 严��g�&yn�辱eҍ�~�h���k�q=�� yi^i���o�c��/�����x�x0�-p ����/���ͫ0� #���v��hؙ� ?p�cl�op�f�@��ʒs���7�x)h�(*��"��"�q�e�����86o�*~������c��jjc"���<�)ф9��}�� vyu{�8�)�� ������igdf��`��w� �5嗵�u5 z�p=���%���������t8�ի �hni����:-��4��t���dfnnp|�w53���h�l.�� q% �i9𘶅�) a�a�30��吶��c��f���<$����=��ą�';;�~}�菘c/��#�-��&�z�|�n�� �%x��]��7��d���dő��w�bs�p�n��m����z�pg��k�:�ǵ�c������燓d�?ì�hb#��ۿ���ҟ����݁8p����o��n��o� a�ݷ�"]�a�� ��.���z��owy˯�y�j�m���|�a�#��h��� *m��v��h���`��ȡ�r4".����wgjk$��5���6f�7��e���[email protected]� a "��� a,rqp9�*�����*�@��`�n��ݶ��)@�{�g�����;������-���s&�9g�l}���Ꮒ����>o=��[��i=c�_���-���kbnai�o����!w���z�������sճd��4je��\����.�� .����  z���]��q �n�h�r�t'3єz¨}�xp>�7}��7`[pvrs ����r[email protected]��0��qjafe�-,���[�ث5/k�ښjb{p����1g�1/ا�n�-w�#��=qi$�� je@ݴ#o� ��gb[b �m!����eδ�;1wsf�� ǧbî���ua'�sd�x9h�t!h�$�������fr���{�݂��!���n�;�^}�~�ś��8ߠu�^����h8�@��t*� e3ϙҗ=���f2*�#�!kc}�j3��-�/��v�ԁr����6jd��b�2bbv��kᓻ_2����d�z�%f��x2d,��k��1 y��rq� ��v�ĩ�rftx�hb�:�ø����7�~'�"�zg!�[hz�������� =�b��ȑ5^k �}"0axij�g��դ�e&�,8a"�][c/���z��bo���l��h� h,ϯ�bu�9�e��fo���ܷ �5�t�o&������滠'�o)�9�9��5zč�6c;��0f��d�d��ʳ9=s���� �eg���o�_��t��ޗ����6��=�\�k�� u;��~���3����nnp�op._�vݨ�u-~ƚ����'t�4���� ��ƴ�[��i��s$o� ��;��i[�����waʟrdf��x�:� &> ]7�ݳ@�h�6�<�a�����9��.�ٟtˆ؛�>`�zh $�h$�f��e���b_#ӗk�9�9�l��0bf��b�˜]��?0&zŷ��b�eb��f���v���h���u&��zݐ�osh�f:|�@�� ��� ������|�����w�ag�����vb���nq9�j;n��ja��p28��i%�̳n���eza����jϥ_�� �2�&�b�w�:3a�h��:}����̓�����{�[email protected]�z�n�:�tqf-u�;��򴓺t�����a'g�m�n�b���9� �ݷ'u�w,��[$�vηj-b[f�jl�qvd���x�l`@\p:zl�r����%f�d�t5 2�m8��ga��xb�؆���a����c� 尤��5�m���.-u��� �gd�lh9ht�d�{m� ��)w����ەtt���ruf�sԡ �1�:���ƌ�ڧ(��6o: ����%�ڭ��!�����oݧ�-�4�:���4q%f����q�v��l������v�;���2��c��7����%��n�q<���µ�ʻw�m�ml��i}/��w�8��w����n-�ă[p�6ꇯ��br~n�wdm���v�� �"ra��� y�.��lg�e���� �l���-vba��0��8�^��ɍh��t���8jk�]}�\s�(o�n��z?潴 v��m�`�u|z����le�h�ycz� ���;=υ_�;�rp���={�[�j� s����� āy�$�����݅fc�vf�j8—����f�ʄ՚i���ɏj�6���gw��}j�5wk��23ub&@���:�c��<�n2�5��u<-�a�h�<�o,��u5�n��r 4� ��)hb z"d jl*���k��'ÿ���� _����c���_���������{����էk��#'w{����jv�j��kwo�0� wcwi�8� �o����`��m6��{��_���gub{����p��8�^f�m5w>=z�lab���#�"j��k��m)ڶ�/$ͽpt��e�e{c��%��tv���2��hi14(�o7nc�� �"���m ���dq�br�z�m9�s ����w�#� �b��}!�!�p�8]a� /q�f�p%�� ���_u d�����b�s*wt��_z]ͳtk-x�6f�m��^���w(�/ymrˮ�;����ydc�l��we5���l��t;��af����b���ai�1���$��rh<:lgjxxxp�oh�f�-9���v��.>%�x �0��px�hd�tl���&-��i�a�� �����w4��"�� �!�ܝ�����~߷[(/����?shw�y���ݨd� !�� lyb j�����с� ~ĝlo'���jddw#��m��nq�.u��zs�^��٨ ;ygb���ղs�6oj��h�}�=�#��b���e|�ᚫy��r��z��r��8�� ?:��v}d go�l��~q�l}[�����dڞ�]!���m�72���t.�� �kqi��"�k�տ�������4�lz�v{�̸p(���2����m��m1)^��f6�&�(�_t.�ѕ��l�4��"����q\gȯ�ݙ�-���d�g���lh��}wekmh�?m�޶��'k�����ym 8�jn��s�xv��b����������?��zo�݃�~�jrf�vo���_��o�����jc�_rt ia�hgk���q#z�a-b�]��ed�����y�w��<&.-*:�sbk���.����c�x<j�$��ol�(-���� m�պwe۱�,��"�b���e�[email protected]�� �j��[:�v2@���y�=��.s�4u)7�k���y�f��4���favo�_�o��m���_ߎ�h>��8��ۏ*n͍kڰ�$�����b�i��fiƪm8�!y(���\�����p�b� �uy�9=�^����9�ڄ�-����?�aj*'8(��`~z �)y�p.!�kh�xm|n��qu ��*" ����=�2���>pfd��ܳ9imrs0�~n��b���em�(}a[��a��f�z���u��0w̹=[:v �t� �x��>���r��y� ʬp����qeƨͱ{ᝯse���ѓ�v��ϫ��ocf⨙:b��h�&��l������{�w�/�i=��ܫ/,��=�x��$rvϊ�u`��t�"��s� ��ȁܪ��a�;�8w0��ryng��#��찱e��6������m��/$&q[�5�45_y�d5�]t�2b�di�x�n��m�t����t7sgjxt��z{�|���~������# ��[ƴf��n��j�l�}�y�_�� o���[² ���� �k�;�� ��j�� 1qs�a������)~��ҏlѕ��: u�fܰ[email protected]ذ�%t�[d���w��d/#�꧅lrz�>�΄���zaf���i�t,yo�2^c��a�ȁ��� uw� ����pd����9p�{���2����ܴ#5՘|�~�j��v�;� ��g��d�ր�p�fr\�d��ܧ՟��,s�q�&�\�?z�€�k|��o�ۉ"3��|�ќh�#]�n-qf>�>�|(:~}`�ڌ�������czk�j���#d\�e������qo$퍎x� ��r4�y��e����fw�z�mv���{w���oʆ���8p7�#�9r}��m�ŀᮾ�og�o��`2��:�mb�f�xe.��9���v�ƿ�����}y�����6� jh/�a"#6s�%7p�zұ�0a'���>x�5 �'•�c�n�,��ab[>�j�p�j�*q�#�y���$l�z�)=��ф�kb#m�k��׬a'm�}z&�a���^�� ��p\j����k�t쭜9!�\�;�c ��� �nܓ���9r7u����7�sp2e�������]��{j��ȣa��7�@�~\�ji�h����'՝ҭc_�ð͵�̙v�����y2k�њ�a{�}n�� ɲ%�@qc_b�~�m1�0�:o� 9��.�� �� j����l�|�i��7>u������;���jus�|�p�γs���w<��?|;y�h ������o����?�� d�����f�'����qa���~�|�s�z�1hnom��g?;_�f[f��o�d|���3�z�$_��a���c7 �_b��܁w�%m}y~�t d�؛��!�p>�sy�:%�1e���7�ʾ�%y��� ������n�u������k���������bl%���f�xw�� :p%����`ks;f�< ý��⮘�w �bzc�8z�����y�����p���i�d��v��&��pv�ج � >�q'&�ʅ��/�^_n����cb�nt�j����(}eq�d�jn ��&�܈���jj�/ʷk�����gu������o�o�q"3za# ������i������l߼ �?�r:ύ-����!��� ���ܗz���g͚��]9[q��co�z�- g��j��2=bcŏ�-��4f���7���o��l�v ��z���a��r�prn�r����?�v���v ��7������� �"3�%f�d �b\ ��b$�/��k�h���� 7���s�wgp�s��j'q���a�ȝy�qїh�$ �@wj�#c�����ݜ�:]~��i��nlgܷ~a�-{|�����?��zo�݃���?i���?n��!v�k�l�j2��j�0� =a�hn��uᛒ ��^i�n/��a�������㟟��rj b��6��d^�y�1��u!_��-�jrbo�=[y��q� 3�h�������ӛ~gy��γ�v�ʄ;�n/��޿�� �r����f�֝&x|s�4s��6�mn���@\6`lc� 6�ۜ��� ���vb�i����t'������{ol���$3=�us��55����>��l�n���q��֏�(�bb���������i��i�qw���hɭ����w�k�c2��n����1�,�)���n���~��s�u��٧-�ֽ��dr?q1�s�#� k^��>��a^��~r!>/�tm�<���i��ѷ`�� �0�xq��p�h��s���v * :�ҵh�8v�_![�����ϸ����@�4(~�������3��rf\hr~� e�~�լ�t햻��|����� nuk&agxh���i�y�|�h��g ̶"|�/֭��>�f��-2 o��i�:zۮ�f�e�諺1�[email protected]�z��a�4�� e�����|��rձ�{[email protected]=q�g�i=[������7���9�ak�����o�z�r��-�ϙx��w�;χg^���ܵ56w}��(������q�,g��,�k��=�9�~8:�dr��ݫ��d�k[wh ��zpia%$px�3n��� ��;�'g���s�f�f�l>t����'��e�g�ɵ~��! �@ɝe���{�靚۹a� �/�o�bnz!��z=�s#,�7"b�y=�,7!��'g�f��uw�|�?�����.����_�y�������ſ<�vη��<5&p�2 *sc�1��qip�}x��h1����f: ��'��d�e�c��&����g;s��=,i��ʴ�k ��gn��{lw��ξw�v��l������>$r]h���ͤ��j�g�zn��r(�p���ufiij�]w�/�ą ��co?�����#�6e[��[��� �'���1/�p?�!.%sc���c���j�;m����]������k-��=����c����� ���l#h��pn�x�կ�q��xc���э�8 ���{p"�����j����x�w�qo9�fz��m�դc�tǻ=�=�`y�mvv�b#��,�͵�pŕ_4�i&�s '� ]/��>k��r��6�.,hښs%i;��b����i�,�a���to�sp��m9]���t�g�r}6)�)��@�t�{�59$��9%=<57:-7.1;�p�#ڦ22,��^{��v�!�&bv�.j^����p=w�0��^q�6�3�� ��o�y�^���cܴuo��t��)�������z���>������[�=s�2g�}>��#c��ee���n�&.� )ͽuj�q�eqf��m w3m�|{@<��|0w����[�� 9�1i1y����o���zk~pf����]�oq�-;�gglڰqsthju�z�����yfe2�� ~%�|ܠoη $h� a� ������{4�׷'b3$@�k0��_�eߚc�b� �ع$����z,*o��^��'wg�֭ i���pj�\r]�]15���io ���;�jb��2sw�w� eu}|�2��������9y�ai�j�s[z�g�����w�����k�����b�o�r�}��-.e�zrqr1���[�a����^44���rup�wnە�'mn��p�_i��\;j��ko~lv<�k��nrvn����2ju52;�ď9�|b͊ժ"���3�ҽe��b �� �ymc���glbz���|^��n��s��/u�u��m���o\m�hx_�v ��4_��64�>9�����ۿs{m�a���wꍫr3$���⎂�8b~d5�w�sb���b��.����6ugfݭ��eu �4�wc�j�x���a��j� ӌq,�6���ۍ(ǀ����]ox�{b�ay�c�)؝�ac 1���_ѧ��p=om:gr�a�����e�� ��f̥�q�eg� ���)����l({�|udx��wuõ��?�`a˦���"*���ʏ((�w� ex�䫳{�h!�w'g��� � �ͧj�����ŵ�[������ d�}�s�gm�v�o�/ ˢ�v�j9ح�_ڮjnt��բ(�3s��m�]��yf�[b�.;�{8��.5-�f(h�;���h��?�g:x%v,�r]y�ٶ rzh�n�ӂ��u�j:n�퓤�n�4���ļ0zw�"�j��z�pr��ɷn9�g�0� ��!�j4c�f�c�oп�?�]zz ;�;/-914�3���������^���ӫ����byq��uljz���z��|ye'��q|���ӈ4z�����[@¿q��~�����c ��e�0�5���̛b�������^��>���/ncl���1mc�r>�8z���r.{��/蚗�q�l6�'}�n���k*]�ckt|��-!!��5օl��=������;]���97 chdhz^��c�~p�6wv��c�l�c�܄ذ�!9�$�����ˍsm7f�<�)2<#��b�t�`bo����j/����'���8�o�r���b�7o�۱!$u�pve��d����.o�t τ��/��ӿ��i��pts���6eo):t"m0���[��;�ŝ���{c#�s"���l�:��|�l dm���� g ֤�c��� �ۃ $h� a� ��}��b����a�4���t��ӫ;�vl�� '���������#:� �����v��/<��t����u����� �h�m(�� ��{� �83;%�i �%�d$ ���w� =:!��a��2-k5h5���!��;�u)�ނ� e��v�uj�(3�4������ ��z�3��]_u���z�`l�(���r�#� �ij� �޲9j]ddhtf8�}h<��9g�ji!q��ïw�d�eiq�b��b �bjb���*� n������-���g��w�=c����b#�e�b�����\���h>u#ǵp�8���vdtj�y�񂱪�>#y_td������������s����q�u��i� '�⫵���@�f�r��d�m���^�t����!n�l�&l��/ �tf�<�&j�|@��ԯ����7�<"���m�=��*y���bė�-� �3b�w�e�s�g��@��u�8*уk�3^�[^كi��lյzwb��f���)�i�oax���3k��z�oev��ħ�������~��5g�w���܍�@�j�0��lď�x�/ԡb�o��0|�4~�x��a�f��p�&��;� ��[��5��7"n{di]h⦰��1�ĭxr.!)�@�"$f�����."*kc��3��?8:�xt���� o�>���l �t� ��m �{�ni͈$fđj# �i��{����ؐ&�'l�k���g2o�nhv�7�(�om̏#e��cc�e�hw�_��nú�^����;��7��tp�vv��ϲck�֫�w��d%g��ro�b�s��'��p���:n��fe%n�j #����^w�xz����gb5z� ( ��� w,*' � ��ʒ�����5,>�wpոp ��. �v�j�t��i`��&��yld{\sޙ�l��>�g��k��č�;@:��}�u��o��mp�y���i�b�s(����p����*����͛c�o _��yq��>�~2x�ţ�y��a [b ��b��"�m{�_�mgrh�-)�""6�gn���xn9]:��;kw�m���s6��ޔ{�(s��>r�ywuusc'$�ed��l��3��5��6�%�n�-� ���l0.t��[m0~8�- <� э'��w���f%�df%�n�ٴ��9b[dlvt|nlb��#�xm(�� ��,#�rjξj�o��}с�)��2�_l�x7��f��-�߷ �?��[��=h� a� $h� ���=����o ��`��������g��b'����.�]�l-�e�ш�d�nj�.�֢��ʸ��4rtfm\.�t"��ߘ�8uс��~�=��`�6����!�����p��c� e�^pe�)'� y��)uƃ��`񜵡df�i�sz��wko� ��t�>n7̟85�)���f�gu��u�t��*2����6�j�苦���h�s �����u$�r_\�t�9����o%�ٖ���\[email protected]�.���yr�0u���*�����aȗg��$�5e�ȧ����:t�y暗�s���!��d��b�)��m#�c ; ��r�{\ تg��v=��@��nc�w}�{����1:��ʛ��9u�y���ɉ�c{�l5 g �zl�^����q�#��� �i��/>ߎ��b\#ʶ�yn�x������d�� �����$��لl&!_1jbvmb5��c�wo��hq��^|� p�:�qtڂ lվ1 �@@4�1�öa� �0�j���l �n �h͔���~�н��l�2�����尸��pmf~e|����ɯ��\�9�@11w~ :m����ٳ�zד������]c�������� r\֑ĝ�����cwh��,`�~en(�ᆩ�dm{���8�5i;���tb�2�q5���j�[�� -&�|3�9�n�b�ǵӓ�����\b^ub5���t�l���u&��?2��_�5�ѐr���@��nj�;;m�m��3��g�h�է0���"m��[�p��[�"3(·=���y�{��_���o���6�w�������?���v�g���}b<�u�x���1����ј�?��s�(��e9��i/�/���μyq՗�ˋͥ� �qe��bfb��o�ϥ�ȱx� g�1b(�tegi��~��f=�m�n�&=,��kjߊrm(k�ǽ� ������)�����29�c���qf�b��� uڱ:�k�b��~u��윃������d����hf6��u�]�g&���q�mv:�8�*�� `t�������a�r�!:�&��&���z"n�&�o�� u3��s>�y��0�~�z7�ἣ�ڙr�“?�����~�.��r�9 g-^��ò��$7�*=t��ez?�� g�f���t�t^����z��x�ods������y�yq���\z�vnl~c mhw�c�lt�4�r�gh]�8�r,�"��z������yz /^з������5 i���p�r���p�(φ��@����n��s���pjn�ii/�l�qk���5�r��z?*7.3m������[�zl��'��x3^����)��s� ��%չ��i�%y������zw��{��.�s:c/���v�h)��ͫ�����]j�ԟ�frvm\quj)9#����0��αw�^�����b^j��x�r��g,�ן5�ﱏ]-8��ϣed ��y�nq��(��䖭��r� �>��*�_���f�a��/���6c~u]ԏ��ܪ�"��b��bvr6��u�]k��{-.�k�w&����k�'n>���-ˍf�č�� ��[�l����� a� $h� a��i�!��ok��f��-�5���v�[email protected]��6 ��x����`\"0����ihh� �w0� a�z�r��y��)��t�zvoz�/q)�w=�k��(�$f�gşbm’�nn���f�d ����?�ʸ�^�վyi�%�y�e^`�a�f���'tz�n��yilp l�@v��_�-��z�h��q&s&�r���j��� rĵ�l��9 �\�������e�a����i�:/���^��k�h�uy�e�7 �0��@l���]��γ��� qy�6��p�v 4�5vd4�(����������[�h<�q�93�(m��5�u�� ��jʋ�x�xi�tm���b;<�y7o�,��^�~ii� ~�i�j\��� �k�b]6��v��s���� ��c�����[愮�m���?�|;"0#<�({<@�ӈ1���0zj��*��##��k(����9���2'1�k�k#$�b ;���2�����50c�1l~��9`��;=� ��:��j�o���[?�^d�7v�?� wm`�x�b<,�wm����q ���v�| t�z��=��5�6�b�bl=̵��i�3��\0ú��/pg��n�вb|^�η-i���xp����>��f������k"�@7o׹�&�i�86td�ef���l۴�0���(s��a|y�:x�����7<嚞p�o��9��'����/�!4zc��l�����% ��7,��^|��vd��:h�����yq�{a1`tl@���i��'��,��� ��_���/����s����_~3�7<������o��vͷ�m��x�3fܔ7��e����ަ,���;�� k^�cd6x�����6�l-^� u2u����xy/o�g�wx��%�e�f�p5:w96oу<�̶"�����\��Ԩl<��c h��7q�$ƴ�t#l����^���n�q@)^�l7ct�ǰ�8v�c� �`�u�q�ٲ��x$��p�1��iz�0ϳu��/ԯ�,���6y����x-���t���a����b�s�nn xe6xb7x��܍�1�o�d�� t��f��^���s ��g�m�k ������x����3�l=�0�xw��jע¸��*}x��{�v ���y��qo/�틕f�m�⺟ۋ4t���:�z���&^������5ܿ"�n������f��{�?�����}ͷ���wnϝ7<�|l=��ʒ�? �o� \ �� �iplg��v���૊��0����h:o�a o*���6ͳ�oj��kln�ļ@�6d`y6׾�u.�&< ,�cxhla�e�gf\��l�� by1�- �!��xr�� �^����.�1��k�mp�:�qw�-q�=�q�a�؀ f���sa��}x�a�֋�3�3'��^bkt��f��ܕ�%�kn~�q��i��vu��r���`��րk��� (��;a�����az�2,��^ɨ�?�a�1�f�x𠏃l5$��2=\�da�t�l�buk����5���*}���|�f�{��w�������]�]�}{� a� $h� c�'��s�����| ıa �¿��y~�ۿ��k ����,� �� u�s��o�w^*���v��f��j�ߋ�_j�����7}��|q?��xr�5��:=�ip4�sy�-^�� ü�u�ؗl��9ɵ�'����lt���o$��vm��: ��#w�u��[l�i-�r`eh�xv?������a�;���x�ƾ�)�¹��8`��k�:=*7#|���@�.�`fe>�j9����g�[��g>�o��?��� ��'�{�z��) � ݧb�|ӗ"�?��>����5�ʝ� �}� �k�ѵ����fw�0�֒��b�-�a�e���t���m|)�~.4}�ю� h� ��-vp�@�'�^���q��w�����i��n� ��g��7�v��m�͑öh���˖�d';ٌ3�$�ödi��(ɒ,���3��� ���v7h�e)������>��fwuu}���էr��u�)�z�nm�v�_?�|��āk��.﬿�c x����hg6 ��i�o����&�6�5 �t�m��t ���x��� ���$���˭����kt�2s�2q��֩�7�s��ǥ�qi��v�3��<� zo���ĺ� � x��٪18��*~�5��6��|��tg�85���;_?�{����瞗/��{a���c\��ܧ'ݯl�꧰�9fjnt��!�*�_-(w�����`�fn�����[_�ݲ����d�>4k�s���e��n'��ͻp�����;���n��{y���{���;�uυ�p��� >?��ّc瘃��g���tͣud�hy� ��ʷ�>����l��������g^==���mo���zk�d0��e%(�>�{[yo��l3�i{d�/�>u ��t��"o9��z��� �s�xo�hmq��[�t�b�0÷'�e�������5;?md^ml:��2ed���tu��(o̔p�qj�~�s�5�8m��mlk�e ��ƨ.r.��.г����ԥ�ԥ��kï]*�y�x���s谩st�����ӵԃ�b�yžaqo��y�f�7�p�����ڠ��_ '��/c����ۮ��g�dnr̬j� ;��;���tjx*(�9����s��?`p�s�j�'p��9l� ��a�]�8u�:[���9xa�l~���}�d\i������/n���w�=t1�깁�3����w���n� �/?w�{a���.��ov�斫v���e�ri�|���t;ss����;��66u������ �����v�f>w���~�v�,�����ά����m�ڛ9wp ���gk��.>34}a[��6�byb�45w����/1����\q��h��tn��.u|r�0���p� ^������)ߞj*���j*���j*�����ncvl1^tcb4�v���%��{k��o��fj�i�j�w"�c_��㒓dc�/1p3� sm��0�#���3����wb��i� ��w�a�el��){{��c5f%h:[r���^�wi�]r[��q����7���ȥ9"�#u���x����ةb��;t`�c�[�naj3��ٚ�ך�ưj kv��٪eum\�0�^^ �r ����=h�b�cmf�*����s*�o]\�p���yզjs�i~�α1�&5��h��ސ`��m��1��7�v}豂��.u�)� �&-y�������z[��6��ό�7f&�a��^ �j���ihlnu��,v=mtzdv��n��\0 �s�cqţ#��4���x��u��l�aԛt��%��5��#ug��k����0�����}f5�����b��j�����dq�vb�ql�c���x0��ɉԑ��w����'lj� j�����vy�ʺ�h.��|�\dȍ�bm\f�`]o  ����&�9e��9�1g4g0�e >�!�1�-��������l�e�@)�͠�/#��͒b�6����a��d3��d�6ʒ3��v�͈fnuh�ce���� )0nf�e����b�q�m�0 (�,��o._�gn�v�9���j�����f������> �!*r ,���qh-��anz/ qe��o����o"�jq� �ckm�k�[�x���� �ě���,����x�*� fkjp�wu�z� 9�e;[o�se�e�^u�~����ҙ[��ufk���������!be)x��wr�//;y%�ߴq8� �<��=�7�p.n�f�u�8�1��ȫ���o��8 ��$y���o�>�q�w�ݒ�hψ� k&�& �zo���ucw�,jvvw7��&�t��t7'�pfn0�q����(�#���ڴ�.v�fh�i�-�?mp��6y�a�%���vj&�@�t4���fe3/�3k0]!k&q7��#�4�/x� ύ��fl� ��q��y�3kgh�g�ai��o� *�s�&�ިz�5,�v��6���d ͒����ζp� ����cu��9t�&up���n��9]����>m�нq� �sh[! �!lt�s��&9'w5�0m��s��/xe��2�|�wi.��srp�a��:c�xh�kq.6f� .&���#����i��o<��-�l2az��b����yk�k>�j�b��ozal�#^���"��[ :�����#�tri%�tri%�t� ���a'�l�|�e������_�����o�v;��f i6���'��#���)�kk���3!�yo � �w ��(ޥ$ad�� ߅�"w5��ycj� kr�e�6 ����kc6u�ѧ7�z5�f���s�����=�# q�&&�����%� [�"ush5k�*�v�w(�"y����n���)��x�a$���l�b�,z� nx�z��ą.�t��r�! z�r`�u� >^���ȅ�,h-�d��� 2� �l�b�9t3j�ulv�&ъo'���,o �֨h��i������u�p̂d�tr�d\�^��^xkc����y�b�fy�g����7 $���0� }����b��l� ��@riх~���#q9&�4g�c�kg���v��y{!�"> �& �k|{�e��u��/‹�շ_m|[86,6�� ����<�rnv��`p�7ϲd�#t�)&9����w��i� #�e����x$gq�o�ea5���&8xl/�(qb �7� ���{|�g4kaq3���&�ƀ^ll���z��� r��j�г���� ��5x/"���i�e9 ���`�l��e'ܲh�pf�em���9u�`9orbl��c��>ʩct���s������iwq���h�ej�0�9�e�`���`1b��}��[email protected]�yfdz;��ѣo"���#'e�\�fj�7t��q�jjpnc�i�̽y�we�兰��4.��b/��������}v?^�� �=bjႏ���a����-!d�b���dti�h�m��c��t�pw��n���jv�syh��*�&�z8��bdl 7 r$���ՙ�h�.�� o塱j�¯�mv�4�u,���j6j4u��b�w;���gy1cu�摵ːq���7t� ^��s2i� y|����a�v=�|�d� ��� b���4fh%��ѳȟ��ƨj�*6� ė�΂끹�[email protected]�\ �dd�d܁�i�.�]���>�e �7�'��9a�3��-��o��ٱev��`���j0u�o�b�l�hl��d�t�du���b��@�h&��0ao^x}~�"ۻ�3��h�v�j����p��;[[email protected] ���_��lz�)����ã�b�qt��h��xr��ϡ�| �]~���m��6�i�<�]�,�[t`g(�w`a�b��^��j0���v`޸���d4d� à!��m�-"�}��,�d�30�)s68o�3y�`axb���"8&'qkԍ�g`��*�֚c�1���0]��h�� �[i��� ztr~�{ b���ξ� �#wa|��(fi7j�5,��{�`m�n��w]�� %�kɔu��_toap�u{��|�p��ng��0�ӌ�\��?��l�q�at�̂�r�<�*vm���za3j�y��b(�b��%�i�h��xe'�b9r-���?h'|{�b�a=��vv� d��kmi�nq)�@`���s�c 4w�ż6�� �()9f�.�6 �ͳ��y�y�� ea�..=�x��w-u,1�%$��7l�[*y�0 l���w�3�ˑ�ߓp��m�m �,-u;�;&��r\[6f��>�������cѣ#f�=j ����j�����̦�n�xgߜ�}�q�n�c�=�n.~~�¿�;�w�iz�6��ӳ���b�������nx���=��/���8llii�]��xڟi �bczi�]ce����e��*��b�k\~��eh�9����8��h��$�k3�.�ۃ1����t\�$n'5g�i�p%���p����_t���.wh9 ����ym�s������j �$ht� s��c�c�6���}�c�_��ɞl��|������񰈠�d� &�ԉ��ѭ?�^:�ɑ���^m�a�� nވ:ݰ�m����j*���j*���h�)�0�oga��0�� ���չ_�����m4w�lvu ��sb�]vp���i�fq�mi&�:��̼k0&�����w�h���`\�rr z&�&�q��w�j1��_3b�2�������-��j��$�@�sb�/�.5v��w���2�iޥw'ն�p��u��{�n�8�)��]r�������꺡t;��8;*�(�x��sk�;z$~�f��y�p"��e'�:�juc�v�e᝿v���ښ�x��d׺=��nl����ѩ ķâ��ݾ�k|�����d��p��p���:��j�?w�_f7�a����]�:��k%�����r/ŕ�skv'����*���k��cwf���v}w���dw��k��<�l� �u���fŭ2�~9��t�ltf=bb�x�|�bq�ɪfy�fk;�=�#‡��@/ձ]��ǀ�k�,�舄n�5�����g7�jk���|�ĉq�p��-#o���x��c�\�ָ���3�nҳ�y�6�n�ѭa�ɉm�ied�fpw���{�����k�/�5����]1���< �|�t���6�rw���k�"��?�>��lv��"��a*�� ����&>�$���ѭ�b�ԧg`*�c��u��a �y o���m��q��j*���j*���j*o��a��u{�ű�8�n4'��]�^>��6_���u���y����ob�a��s�����ib�sr��p�&5t��d�%��ꓼ� ���\�~.�,]i�,�\ag�w#������5ދ�.�kc�m���k !�s���\ru5���sj���hڽ��u]u�|&�n�t����{`] ��!�a��\l�� ,�m�n�y�*�.�����u'���z��7�'w)g�����g� ��ѧ�^/���2��v����%���6��;�[l� ��� ޠ�ed@ 0�ge�(z�l���p��� ���t�duk��x��l�kt���vܿ\�5&a���5*��d�\����z�v�/����k�y�)~�b��=bqtsrg%n>�!��쑼_��a>�i�va��&~��7{���-.�/ƅc�� �裹���_я�rn0� �k.�yir����9�7t��yd �fa m�`� ��k��o����}"�z�_gg�}l�k�_���kh<���w�a�y�py�>\e��ָ�m�#��:��r�i�ϡ�g���w�i�fe��as��ulvk�����f6�or�����(�p�v�x �}f�׻�ޥ�'[��ol���[email protected]��y0�2�wo�fr�}����u������w�aj�� ��w�r�������������l��*�� ��[9������o~{; ;qt�wg!�֋>�׻�[��|�yd��^��h%�tri%�tri%�'e�|{�� ;a��d�nf��onfg�������ڑ畓ò �>x&����c|�w�ݲ�>�ļn�*,f��}@�����7���x~$�m��@݆bv���e�c�d�v�i�}|� |�r�jk=�߷���:�'���m�4��,v�)��5���9}n^�q(_@�f�f�&l�'j�:�7jml�q�:�]?�s��y���s�}���ol|���q�fxź��w���(�얭�`ѣmj.���4o�b��fi���n�qv_�����gu��^l~��0yݲ�-�����z�:[~\�?�_�`k���r�r�n��� � ��9f�h�/����aft6r'�2m`'�����̷wӎ�����n�]�>�x��o��vt�|�����`�3x��`@n�š ��q� u;#ws��qݜ�a���k���a�� �{��?m��[email protected] ��p�p}x�׸�r[i� �������w[���bu{ht���5��`��v���3o�'�cl��|�2�{ ��z��,�}ڋ>��w��܏덿�!���jk�����s��ؤf?^}�(�:�������熵��@�b�yp�����7� b�5��@��4�}�#��ir�p��`�$�ὧ^5w�����@׭���蓅��b��bxm�{���c )ߞj*���j*���j*o����^o�vz���������gw���m����z��ʑ�r��]\ ����4�`��=��ޥ9��;c�=$:e�.��nһ����b��h��a�f�i��[���e���e��:�d¯x��׬�\1s5 s��ԍ͓��a�t��}�ض�#�>�ݹ;�t�b���ӽ}��ͼǹ^��ۍ��q�z�y���oz��z��u�9�� ��.[�b��sj�emfw�`�&�*��fa���.���2��[ ��jn^� �p��l�z��u�͂�_���� o]�̓z{h��� �^�����n�jg��o��\� ��֊���7�����[email protected]�����lq�\ψ^^��p�#�j��k�@obr��e�a�}���v��v���w�o�3��j7?b#r��f����(���˟�f�������= ���f3u�p5i�(�vi��� ji'�h�ȑ׬�b�� �c�g�p�g��� ^~^� �[�� ��s��]����0���z�o�w���ˋ����f7��s�tri%�tri%�tri� �^l�%���bx3��磏�����z��ww)�!ͥ�`p 6 ��/#x���c� �e�*jvi1k�yl�����b�u��"�;�9y;�/������kfv5u#�y��e77o���v����~l[���?��� w~=}�p|��b����\����'���&�gugx6i�$���eif�2�|���f�ia��)ȷ�$��n�)���e@ 2rkp $���}����: q� {ݰ��uz=��@|���oa9q���a�ي���6kav� ��q��et{������w��d�1�.rݥx b�q���h�d���x�0> ��6���j ���?��>�����(�ew?�9r��֌�5>s�[a6�{�`�&��l�܎�@k;9e�g�>�.;��zh컋>ߎ������?}��m~�o��� �~i!��}֋n�pv{*���j*���j*��� �e�"ďe���ν��b�ō��ѿ�����_�����n��6��y�����ne�πl㲍���d� �r�1�"�8�~��g˓��d�@a���e7w&&\�c ����n������ hnfs u������2�������\������y���!&���_�ѧwzg�����ɿ��}�~bt�,m�d�(��l��� �~�0=cl��p�k�f�(���..���`j/a1i�,�fq6��m�m���b�h��7w��ѧ�;��f���j� �|.� �^w!�v��{?�d�ݗ��v*�le��<��hޣ8�z�iբ� �n� ��x�/�z��%��c�-r�"&l\��'y�n����v��#����54g�^x �n���q����ܱ ��}�����~�v06iإvkvy6�5̆١v ��$�x2`jw`�)���f�yj� �`!ɖ��d�q�r�qm1s��.�q�թme�1v�,yjux���s��s����`�d�u>}����o��s��=�gw>��۞��;z�󕅰�]�6v\��������*��v�f�8x ����.^ۻp]ϥ�/[ߵ`]�µ�w����:&wi]k�t3�^�� ��u�ǝ�랾rs���y��a�*a����pl}<�n%�% ��`0 �������h1:�pm�����������_,]��o����5m�ww,z�q��΋��x��.���׵_����׷_�g��s�= ��\��v��leo�"%y����� vv-\�u劮�躊�����\�{���e�m[����ۺ/_յpu�u��~t�s׬i�����o_h���x<������ǹm��gj�e�c_��u�,��6cۅ:>����;;�߹�c��<�;헯�by����k���e�u-z�%��;�ѿ�� 2n����׬����[�y��ۺ��h�jy�u ��x�;������ dunq���>�8�$�=qx�v��g{v�����j��?�����;?��w��ޫwt3���\r{����ł�r�kn�zeׇ�wy{'c�w{�� ��~���]��tu���w��xr[��v>���<���r4��r���t�h�����?���7v�������>mlj����;;?��k���˖wk��^dum4���.�y������x����:߷���k��gׇ�t^���5헬i���� �h�j��%�mwo���uo~xs�-��6�����p0��1 ��= ��n0 ��`0�m(�sj���sj��3/����޶��_\��ϭ}򓫟^�v�µm��m�d}�e�u���\�1c��wn�x�� ���.z�yٲ����]��˙��tr�|s?����k��z/_ֻ`y��[��w��u��e̠�/�^���e �_�r���,x�q��� o}�eo_���s?����ҟ��=���푧[email protected]/ԡ{� ?��������q�c �?~����v�w;?�������{[�o�<�;m���^�˿�s���xqyo�ۻ�lu�ew�_����5m�������m׬�������l[�l��[��|z��:�}l�?�q?�&���!l�(�qqc4dv=�趵w������g�uh������<�������w?��6_�j˅k�^���m\�v᪎���^����n��6��[�ٻpyς�m���:߷��?����� ׷_�����m �� ׷]�~���\�v�uo}x��������"�"d�4�p��wa�cz��`0 ��p�a$wm�q���'� ��݇��|�=��/��m����_z`����/ݴ� �iǵ츎���~�o����m�g>���_���7���~�\���3�w�fiw���_�o�ᮛ��u�=;ob޽�ƻw�p�υw�zz�s7�����}��;��k� wu�|w�w����^����a� ���u �b���"�q���@�v??�_�x�h�_��� t}��g>�����x��~���������?��{v/��>��ݸ�7�߽{�w/�w� ��q������7=��k��}����v~�]�ܿ��{��|�����~ã;�k�_�� �7*��g>m�k�s��� ��_=����o����>��{�}�_�w�w����w~�y���ܷ�����g;nn�ϛ���!����y�=�n�v3n޻� �����=�>�{���|�go��7ݳ��?�~������˻�j ���� %q������o>�������z����g6m��#۹�����>�����"��8n������������=��/��)�;?�i��7����?������(�6�|�˛��ҧn���;o{���øt)u'pk1r��n62 ��`0 g dmw�)��@�tղihb̿ ��y[-��x��5�a"�k��q�` �:r����ij��x/��k��ߍ�d ������j����� ��q'�y�,}�f��vi<�v���w�]��`0 ��,jz���$�tt���_x�����>lo*�* y�"��x�2�pb���$ r���il. ���vfk���r4o]s� �h��f/z{!o�4l7���8�@�ь[email protected]гe�*�q�}1&u110v�!ʈ�$��1�b���,�7�x�v���r�jɖü�e ~)��v"ސ��[email protected]�urgq"��s^~�n [�,9mail protected]��8��!�$�����o 8x�&�w� �a�����n0 ��`0�uh��l���>��n�v�_ �lex���xv�t�(�5a��g���� ɿf�]�fddsp'���#�jf{a$$if���g�ޞ y:��0⠬�y��/d6 ��9j �o�b�5&៕a-gx^@��1��._3��8��vԟ� !�q)z{-ơ��.*����ν��gf�a�$����h/�b�pl����{�-��!�<ao4�]74c�����b��р".r�h�picdu��͌�)me�� �8ӱ������`��5�q�b�2ae�<��>��뉳�1�;s"�z>��h�#ɔ��5ǚ>�u��ԇ�e��o�#��ԅ����{ݱ'{y�٠�>x2 ��`0 otko�l���4�}"fs��ޮ�]'�����^�ܱ���w��o�ޞ��h{�z{�]�g��c�"j"13ie�b������koop�=���ޞ�f#�{�r�=�pz����n4��}��z{$��.����v��`0 ���i��e]�|j4�}��퉗|�d�j�|~;���nlo�z�s����v;5z�z�{p�&��-�v�i���=�{9���{m����bowb�"ߕ��t�ۍo�]�v��0�]�eyowz����f��jz��x��#��۽����`0 �!c��ɳ�$�)$�)���ʪr��5\�<�y�bk���2&d��jg]y �w����'�ŕay�a׵����?j����=/� ���h�i��b�w�bhqs�o*�e&�d����zjxu �"�$?�4��r��#��rј1�n�l� ŕ#l��-�&�_��e*�֏j� �0l- 󕧰()k� %rd��a\�%�]�/�°��x��dm,,�`zd��~ ��`0 ����&p��zӭ�!�ʆ�4�.�2��# _����i�lz�\�9�ގ��e��{��7>�ޞ��aoz���oz��"���ǁa���e�nu����i�ao0��x���^ ��t�h��`#�r"���7�v�"�kڠ����o��s�ߠao�w�}��v������:����������`0 �!�(z�l�tr r����j��'l��z;`hz��\o�����k(������5�z���o��fޠ�����`�ʒ���0z{�i��a���lo7nlo7 ��`0 ��i��苔�%u���aa�l ��n8�ݸ`<��sfnp��l�)�n1 � ��*r6g~��. ���(rp�#�>w�l�*��\�0w�q0o���κl�) $�� s�c�<������؇�d[�b )ӓs��� � d �"j�ue�)��#/�ǔ��bu>�z�8qȝ&km:s�� _��� ����j�,pr���jv�f������^�)�ɣ�2{�ۗ���u:�(���6�n$�ubf��9]**"ߢ�7�#�ԯ�3_�k5� ��f�`t�l�/ܯ� k�{��� q�"�.�[����c�5 ko���&a,��)=��n0 ��`0�]p�hȑtӆ��lo��!�=�o��������n�k��i%�j�b�<��x��c��qo����j�6���5w,�z{bql������a3� �l�� ��l:�i���^ 9��6��n�\f�*/���1�d�c�<�()�^�g�-� ����k�l��zs��4q])�=��n�o�vhlo7o��ޠ�;�=?���x, ��n0 ��`0��($p�����uuo���ՙ��1p���e�fڛh�ao?��뿖��ϛ��<| �ɝrj dv���@h�լ�h��~ic>&��i_��1mu����s��_������q������)0��îw���_��0 #���4-�t1�?"��~f� ǡ �tux��|�]ֲl_���ah��}}]�.:���wv�g8�����r�c�c>� >�x�n[�=���� ���aw�)�w�p�5�1�vv�d}'r]� }u�8֯'xg�y]&��z2 0��fw̨yy^exe�p��:��ە�v�ca�3l�d�<�'d��ds����a�ax�1�c]^ ��p b(<�d��&h�ᇲd[jå�w�]�=q�`^ ܱn}�?���c.��v�6��[email protected]߯; ����f�7����oar�'/k&�r{����̈́y����&�=u��bq��far(3���� ^�9��,0���b�q�s\�y�c;i?}�vw��8��m�x�)�#ݤ�1"�ao>&�a�aѷn^c�j�z�w�/��wp�f{�����1����cv�p�;v�8fh:�# c�k'6�f��ba}ixjo�r��j>q�9�/�bi��� '��`0 �1�y2hp�|�o��\���`;�3�'ha�࡞c����e�1i5[���o�c�8��\.��;�ڎ� %s�f��n���j�x�>q #� ���3��=��_�2e�ğ���:��|��0�_��@p��?g;/ if�qê�je!�l�$z�!�\ @ ��f���s͋�nd �l]������x���b$}>����x�t5��$��f���s��8esw�%}���/�� �*v�~��c�x�y��?u10��t�}�x%�й��yϛ�g�o�|���p�����#yw�j�k oy|�=q�:�pl����ls�3�%gᘅ����ڍ��<��}<vy 7 ��`0 pq!b<����.�.��v­�6���h@=�n�ne��#��υ�b ;��dwcn&z�ħ� �����|�p ���/o07;��q�<0վ��w���6�7 ����@�y�>�(����ҫ5�#�m��3 9j�hi.ӎy�������:�@8��@ ��l`��{<��{��-�o�@�����o wl օ�ql �[����meie��g;��.| u�u��'~ ��� ���^�.�����n��w�z;bjї~������[��e3����û��i<�m��q�v�ş�6�fz��i!=�� ��k� m�-b'i�nt=�:=���õc8j��#�����i��->�w��"�-����t����}a-�j^֎�n�b��u��>x�2��;k��]��#�bfu��oѡ���݅;��z����cy,��uc|i.��12�/�]cxvfx��<n��j���]���n/n½� �܄d�j^"��#���2�ix�ɽfzu~�-{��-��rk(~'�q�񌍄��,��d_ax��q2* y������x�%ty�� ��*�������ǻk^��r�e��,�yg����`6h�elj�oi,q��#*��:�u�����g۲�al���hy�1�����sg~z��ڣ�t۰a���af���ׁ�o�#dic��� ��`0&.x(�&�y��/�%��,���4�g �!�\d� �"nw�⿈�!mg� 8���3��3���lg��悟����0�� !��8�9b����3��b������v���w�e��z���� ��˦��z�gqr�� � �,y����q��b�}�� �}��w}��ӕ3� �<*)�� h��uu����v�� <���8;/6����f�q��8;�y1^���^j��0݇&��$���༈ �<�9����y���.0��|�87�yc4/��9�� g��$�#���b2� 0���̈���p�6��'_qә\!9g)g �� �.5�>8]>��s��?�>yko������e����x̦�ij�s���nݝ�xi�~(��lej�dh}pz��h3c��,tl9��ogd�̝3���tio��2[9'p�̌��ʙy�bg�� jԛ��a�u�f�p�w��1�#p�; q�}�����-6���i�s��(}/��f7c93�3�p�͌����~�r���� �q8'��|y�k� g]}��� �.p���м���.w��$�����ъ��,g�;�f��%� �x��07�ylgr �9��@kvd�� �7�������y ai���c�d�9;x�bl3��wl�ș��v���9�����[ȣ�ei�zѱ����v�8� n�z�y���>> �l� �d�gj����q�m��!��m��c ]$ �<��{i�a0 ��`0��7�]�i|���������t*`a�&rj�b��䰙�|�_�b�j.����dt�ub~"a��y�����bw�`����6����j��sj�.��)q�w���g�л�չ9ß�����@�^���"k��&isp�p� yu����~"��@s ��}���7yq � ��$l.�hdj�^luj���[<�)����ɋ$mtk�j�j���lu���{��f �x-���ꆁ\3r�\��[��?j���dž�w��^o��q��g��c����cf�m0w,5 4f�����bjbe�b9��~]w�f��#�n꣦����$�n�h �v��s7�3 o�d*%�)a�mbbҕ��!h �d?���e��j�ju!�ya�c�-���h����7�r̬����x� b����b/n���,�4fh�����tso�= 8j�^3���p����n���q1�sz2���} i���z{@�v z{��a�� zi�����������6�k�z�f�[9 p٘�״�}��l`�r�:��c=h �2�|��c5�|��p�[��s鎵_h�pڌ�}5j��ee��s���p�.:z��>a���p�3�=_��% ��ƪ鴁����u� ������`0 �7 t� �^��q�v� bzkyo��to�_�.�g���q��ؽ�i�hq�w� �tih3�[email protected]�r��b0 ��`ő gr=]�x>�y�p��a�ق�z�%��( ܂���p�����f49�)1��jz�|�$&p j#"l�v�䳚�[�1mrr�x��gki����v�'3�k���fm��������܎��� ����i�f��d�����;�kւ�|�� ���d�n��.>��s��z�~����t� �a � ����ڃ�&����i���za |j��jp�fj����|����j��-!�cs���܏m�д�s��fl���u�r�ƴ�ž�l.�r:��sɝc�]�7'krc���*��~���rh�>���j�-�m�'�� ��a��otpie^��x�l!����zk���je����u(�)� ����n�%0�[ ru��="b��o�b1��9�lv4yb�>�/��� -w��s �e�z g!��9*n���̸v����4�[��i����,���݂xnp\o*�l �a"aֳ7rܧ2���1z �=�~��&4)"��� y�#��k'x  ��-�z�td1��8�;�t�9�k��uq�y��$!f����|s��d՛�[dm�91jϩnx =>�>��xj��_9m%��o�i)�r%_1�h�s���x�و��� ��~3s4�beԪ.ވ�gm�k��\�����p_���\�3��7;��e�w�sm�mc �t�\h� ~��󙼙��7�[email protected]����b?�k*ẗ́��;�k�v���d�jr�뭷 ^a�?.��p��z��d��])3~��� i�]*�xs�j��ҩ���s���b���i�*7'pi] �i�a&e���y����l���5��nm�tp6�-�ɵl�q_y���"��~�bu���.��k�=��*���vk��2��u)>^ ����|sq���=��խ$}�<^� p �y�\r�i�p��)'{�칃�ޡ�' lӱ�c`��nv��w]։�?�u�l����s—f��g��y�1���������c���v5�f5!���t�0�p҂���ܜ�u�����n��8�^�pz sl�>�e�k7�.)~*m0,�5�퓊_����^ h�$w���q�j ��sr����r7ꦑ�њ�ȥ�fv��8|�s��g��^cxٗ���iu y��[�#m0w�@ yb��r$g���8]z�� �1�vg�� ��`0&n������й[email protected] �)�(��6�i[��ȕdk? �r�vї�d�%����|�z�[uz;5�ˈl$z�ۆj����=w]�t��9ox�]��֒�4��^��ʘ��jp�̬��tv)����z�l��d��)~�?�pnp�dŽs=��<�ail3��y[��yj��ɞz2픟��%��m�����*�����%h${�m���gx�)u����~�����'�=����|sf��<#��lo�)���0pjn?a��b8� �k��bie>]3f)ߚt�z{?��)�~�r%� �h�h�e���%�7a�4��1z����k �3�_�#!_䜔ޜҹ�^�$�iu��udd���(ob� !ao/j���ujj����|�q3p=�?o^ͭkb��7�'攰� �ߔ�w�# ��� �"�$�4d�ӯ�7oo��z�w�5��l����t3��b�&�m�u�p��*�������-��a��cs ��2d���t2��0�j��.��g�9l����j�ea%1oc���c/��䧉yk��n����o&�v�u�?��oj^hb aj3b c"2q�$ؠ.-�r�.��kj�k�[]����e���nu��3s�`h��[email protected] �{w8���o�s�}/� ��$�^{���}��{�o���~���(kf�&a;fj��s���z(��\��� � �<'�� ���7?�dy�7p�ʼn��o﷼ݚ5k֬y�f�ځh���������zߑ&k7����y���.v�[email protected]�hvp�*@���*msj��f�c�2��٥u:���)��~� |wj㘝)��%i���bޮ^��?x�����u�eeb0�@��ۣխ�t��%��t�%v"����\�����o�=�c� ju��[email protected]��5���u�cc竳�m ]e �毪���al�@;��h���b���w�e99hӹ���c;�g��-��f��/#�b�ό4/i������j�=�b�o�c�f�������x�$��j°�y{f��n���v�'���vb�.�vҡ��'cd;1~��w`a�6id=�u�%�?2�lnđ)�u��/����\�/�¼��(�7j�q=��ew��?�$�on�;ň �301��r�qtީ_x�n� ��j�,q�"��®�=u}�!�~n��g���;ow;u�x}{�i��1}��n�� �������ڻ{3i[x7��j��,c��eiaib$���g�~p�h#��$��ev��n�js�0:m3�lw�i��\�n���94 {u�j��k�z u�ΐ<�ny4�m6�"��z�1�?���7u���g ���]j�����/���x�>z3����x�h���[����}g{���֬y�f͚5k�8ۗ�p�ҷ�����۳-r�jc�)�>��l3h��!��2�qu�i:`\��t j����&��3?��r�fl|��^��������}\����%����e��= �� ��(o�:n>��umc��p�,��)wwz ^w�nnj�<����okӿ�w��u����'�j�r,����el���,��� #i㼊4���it4v����oa`� �!�j3����< �g����g�h���m�]rm���-�����j!%@�*q�mc�n�u�u=?؍����p}-oo| ���&��_4v�>��q��� o�vs���a�ۭy�f͚5k֬��з�ݕ�wwg!��l5j��vi�@njxޗjڃ�s3���"a�w��||�����?��]���gݻ���%�y���v��cx�k�oq�p���v�����}۽��1d�6�������j���y=wx� ��r���y��u�z޾'o��&ַ�i��sb�3�]x��^��1�gƹ�}w�nfchrmuc�g t�=k\�^��e�g�mkgiw�����a�*�4�^�9�ov�2d�l��@b�i���i���o7�@i���ܦa⡞!�, f�r�*ԅ�}�1�=�ܻ����]e�n�de��uw�f �tb]�c�{���ʊ)����|!��\���[email protected]�b��/���aun d]f��j��ٹ � �n� t�¨m_��f��[email protected]�ygc�[��v��;q�%���u�$g�a�ӟt e?{s�r�b�9�5!h'�z:�v��$��d�<�d�j��<� �p4.�� u�}913'�a3�^7%2��s[�����z'�fe�y3��enm�ҹo�z� 00�$��@�ϗ�n������/q��,�v��o(��~]�=9nn� ]�ݲ���%t� o����v���:����ph�:� |�s�$�xd�*�� pn��ڧ2j"�x3౨ ���frăģqr�k�n�r�^s()q�ǣ� {�i ob1��j���_�n�e �*��v�k��a���jd�f���##w�o��rһ��;e�,����9y�<��;nr�)�e����ԝ���y���rĺ��֬y�f͚5k֬�q�/y;�f�o�#���y����� o/�y��!���ow��fy��;�z}m��*������9 y`t�� ���p��2� �hr�i�tf0v�����}�>�o��-oτ��g�����1i�@p[����нƽ9���;m3�ף'�llw�>��k(wd��@rd�#fo=�j�9�s#'��v���u4����� �}3��f�qގ�e~�����x�^x{ќ6i^�6_ ow���s �3�'��m��u����� 9=8��v��� �n��^y�n$�f�1�=p& �����!�h'��y��?���o�p���r��5��:v�2���r,o��þ�n>����/y{v�0y�,k,o�/y;�l��5hy�5k֬y�f͚�����}��w$�ͭ��r�|�d؄�xf y�x�pѫ"��a�ғt.�d�7zf ��ή���`soa(�f��sx ځh:b�s�!�;�55w{�}b�����`�ufھ� _?e׬nގ9-o�ۑ�ӗ�h��� �g�?������e� l2�ցҿҟ׸d o\�{�u��3�gn'ƻl�%}�i����@܀jj�$�7�; �a� e� ��ph ����^�����=����o�w=�z2�a�<�c��>��'ϩq6z�q�asswm�s�m�;��0 i�h�t���]e���u��a�uo9a������ �%� *����0��r�o ���2"�:�l.%���%�_������[vsl�-�8�y<ʢ�.�z���$}%s����)��254��oh-�d� ��%hh9�t��p�q@��azy �hg���s*:d�=֖[}��ב�����{ib2���k��@�3�����7�tw.��p7�7u:�u�c��kl�b�dhs�y8�qԁ0~l� f�53� ��f*c m�j�s�j���mdda(b݊2e �iv�{�d�)l)r \��sty3�[�[ĉ�s؝�=n�1'������{kzh���"}e��a������}���֬y�f͚5k�h�k��[z����]4ĝ��s�pu�d,��`�h�%w�,�ͮs�l�xo9b缝$^�r�����z�٨�bz֌!� u����5�v�-'6�g�폃��3��������v���2o'�y��c�ud�ٶ��y�^ f�`�@r���"�e��uvub�:��jv� ��ev&�%��� ly領g8�xma�2#"׎q����h�#���#[email protected]���� 䵻?>/���o�$�a�b���f[`y�5k֬y�f͚���0ޮ�z&��nn��� 9����s���� �.i$��b�o�%��j o'������d�yր,�c�7p a����ۣ�w����t;�� h�^�y ��=ȳ�����qɲ��x;]i;��;��n2l����� �����;\-o�f͚5k֬y�f��i���k}{���j.��_g�0p�nyo� �"�"i������'��f/o ���%6k��a��e[0e⨐�;f h�l���ky1h6e����tx�o��k� z��,&" $��h��u �;,o'��;f�evsif�]u5�e� �5�^7w��u����{�u�u$@t��� 4d 6 fs���"7o�?����x,�f���jv���0r7��� xb0{�*@ub���7��d���oq���}j&z�0 ����pn�ď��tɕ�햷o�ds3�4�m��c�:�7z0cț��f�oƙ��f���h3d���b� ڌ�j�m���*tj�����w��*���`���&�d�pfmg� �h܌|ut��e�d$m�ȥa��~��)�t/@ ��jucyqopqba�n�u���2)�o�oa�[email protected]��>�� � �8)�s�bl��v�o1��zly8�abvwh���m}��2, ars�&���s��ppb����k � ds�td � $�v���"�(�8 �@�c l(3�p�d*�ۭ��=[�p���h��;e *�qꠌq�r�4�) l3ٙ��i���co�eeb�yxg��3zv���p ,u4�1�h�n�mũbzf)�pà4k$��s�6k���שqy� ���2��e�gp�`{�2��̶1w�ļ����.�� ��w�e���zy�6�v3ӷ�rj���zu>����˝)�([fcj���2\u�u���_��a}��탖�[�f͚5k֬y;m_�v }��������i�_jn��x��n�jі 0��h}h�$��! ���:�2�2u��(s=!k�s�4{i�jv��t��ᒄ��u�|�7�p1�w����c(�/��y_v;�1|vs�f��@8�y{�wdz٥e(�fje�8r��>�ӻ*��c��[email protected]�ư��,@��;z�y�r��xab~^�okù-}v�> 'bk��ߪ�e.�z�v�hy��k�:�����b�$l���r��j^/ż�z['�p�z����ș6�#�ؘ���a��m���pb�0���������~�ەi;�=f�� 9�x;s$��ƶׁ�eє�a�)|��8��u�-��t��x'�a�_���r���:?�f���� [��.nq�£�ޫl���@�b�}��$��4��q��ez]��bp(5w�z��t{�*�b��@����9�2��b}��!9�i'nj uu�� )�&��i�i9��p�g�x�0�ƙ#�ӆ� ����� ��,c0�����4��ö�� ��h�2c�g�8!8t��i8o�;߁z%� ur�r�h�����m����&��ć��ϟ��p\��b��x�v��ԇ "=����lv���(�,o����*(cw�dʈ�\��a)s-f�x���p_ �]b_!�*�����غ�� ޚ��ni|�dx���1��ij�˾ pfu�ij.!j14q,heu�����qj�,�2�u�( ���6s5���t����ͯy×�0��]ô�t!�y�]-�[}��( pn�tu"�c�f���(`z����u�ޠ�b���*�\'�cz�� ����] �2��im�k�n?����6�<ǘ�[ߟx;������vk֬y�f͚5k��s}{��'�r��]a�c2�ӻte��y?� �4��)b�f���(18� yѫh��u����isg�y��w�|�b�a^[email protected]�f��:��$i�i�_iw���"��&��ȳv��o?����<�iݽmș=d�y�v�:i_�ݺ ��x3s:@j�ӧ�h �, c-qu�9 ��{i�a�[r�×���e�{�տ\r�c�y���ϝ������}`��7�z��{/�����v�ew�{ǫg/x���ͼ�`8��8h�f��ԡ$.$�i�����;�glz�u�����w��������l��e) �9�q虼4�xhs��o?rʺu箻�=kw}`��}��6^^������ၑfo���-��o�>v� 5|��[�ٸ���/�{r䈗d���)����d(g�e���z�77�{���m>��w�=�lަ�[�n�(b�x���vq��{����]��k�xw�����p�5=t��7^{�co_���g��y�9}��m��ʟ��_�x��;�x���x}�.ذ��-�&8��,(e9��ۭ��]���c��4z��x;��4z���g��뭏�s�ƶ�y�����\w������-�a-�g�c]s��e�j_��5� ��ͩ���m(&xvp▱@���%y���(��"�b�a�f���o=)��s�44��>l��.��)մh�5k,�[�g�n�~�<�z�q�:�l��g~���{�����57��������޻�zகk~���߮\�꺵�ܰ���{�-[7��lj\�>6��ʼn����}��vk֬y�f͚5k��x{rs�:[�!)�v�mr�ub=m���(�"�h9z� ��@�h,��]�_눽j���x�1wa��w[`v���h4�@h�� �'h i2�n3� d��u��ü\�f:o�޴}����;o��|��v� ��!em��'�!w����=�5�r��7׷3%3�d���d{-���]�-�8_��|w�.\uiſtg��u򄙧 �9k�57���þ]u�7�q��uf30{�м9�n:a`��w^>���5���^i�#�^�c�g�t�e������=e��u��k/����vy�l��o؜���3�w~���.~o�o�yƪms_�) � $��3ky�a��g��v�@ь���j^q�3�� / ���ly����[����sn8u�e3]t� �?t�iso�3t�� '̝t�‰s�r抡�u>����?��.t2�ء�¼ɛf1�h�v�߬^w������4k� g �qj߇n���_x*�h�곾� ����~���� �o�?sʢ����c?wk��~�{� ��u���m����b��ns�dzyhs��u?�|��x凋7}����e��h�x�u���x(���\c�]sw�k�-���������w�{~`' j�c�= p�=������rk�䓇f3q����0���ų'͟?��cg��]|��g?[�����²�6�ag�]�m�p���� ͛;����_:��օ��~��������x�ۭ�)��,*4�v3��ό)�'�� �e!�'�r��/����g�x?eɣӏ2�����o�;y��s=� zsʹ�&��o�_�=z�l����&�4�2!w���qo_��x{)�rs�-]p�x�*�w� qqբ ��䪐����[email protected]>3� ����=q1u�6aއ�dl�����5�m�'�|k����6k93���* kٷ枉�~��҅˧m={�!�n�vڜ)��n>�i�gr��i�n��脉�n���)&o^z���?s~`u%i���,�4�����b��;\-o�f͚5k֬y�f��i���nt���v�i'[email protected]?���ӥ&e����ot�bi�v5$m��ɉ����ndj��e4��^�c� ʇmc����n�8p�;�xģ�`��q{�; <�dz���m��q?��v�ۻ�=��x{��\r�i�kj9�an*d���y��w�vw�(���#����ߝ�vć�y� b��n�]���������l���,�x���c' �bə~�{�;�/~-\���h�[yqs�߾y����#���u��or|����� ����(�(���y�!_���e ���x���q�zb����@0�g��a��;�7�{��c��v���vź��1cy��\���=�~�ۡp4n��w�&s|���"|����u?�~����ѓ�>�����ylj�.�o^�.\,8�?�m�i�s�:k�v>�a��q7l���ts���ə%) %y���i�����-]�ϝ�͝�<':}��2��o�w�u^��� �]ô��v�? ?�����i'���g�]s���|��/}���g���۰��) )b���ɛ�����/��_r�;�tw�u���sm��&f�ie�\ �a�2���!����?���̹υ ��j��m=/�e�]ǐ��*�.&*��w�s�����/t��q�� ߼� n�o����߅��&�ol������ۼ�/��/n[�-\,\�x��/z�~_�'i�d���v*��������3o�!ay��犔�$0?kr�l���)�{������ 3'ds�n��������ʲy������ydžk�x7~���o램��h�q����1�d��}�\ ���dk($2lu$ �h^}$��ĵ ���*)u�t(�5���k� �j��h�3�֭�vڣ���/�yƙ^ŵ��4��ob��8!l�h���-��m�b�5�əe����w���•gϙr���<b�;}f4oaa���%����3nso?�_p�w� w�\�cr��r�m�mee7� �0�v����x0f�n������g��y#j��vk֬y�f͚5k��[}��f��&o7αi��n�:f�i�%�����v�in�=�}�vq܊� �ߙ�����/?w� ��2|����fz��uԤ�]s0�$�o�6��moyjӕ�o�n����_�tög�ݶ銭o]�u��;_>/i��sdz���–��my�kϯ���\�@be��]�]%'iq)��!���88�y;�#�okǵ���v�#v{���\d����� ��@ڸ�бy�)m z�!hu�i�����=���q����t��3�d�����g �g�vi�����}�|��p��:��o���x��qet4(p����o�=���-s�8���/����ɐ����e�^m�����o�ly�:n�q����/5n�xtxh���y�=��n}{@t�����\`2e4�̘�$#�8r�h�@y*u����i���o}����o}�x��c������g������=�l��3��'������y��j��g� ���tǭ_�h�р���q��쒟|���o<�8���������j�>=}�w�����%k�?�|u�5j�0���c�ヿ������� ?��~s_�d�g� o���qt�u�s��sg{������pobuζ���_��-���3*^\w�-��ٯ����ɒ�[email protected]�m$�����}��w�*�ud��[email protected]�����b�,��s�b�gяg�k /�t' �����k̅�al��a��y��%�[��x3�@$k͙w.]lڼ)�vy��^bpާ��#>$��1�z�.�� 5`�"�j0��iqld�è�o�x��i�]t����rށ��g��l d�мw.&\. �t]�w������on�|��:k6?c:��qp]m@ ��1bo�s� m��˒��:r�t�bg��ܯ����k�]�&m�4iҥi�r�o���hny�wjh5d�u[������}i_�9�t��v��� o9� y���kwg�������n_�_1�a�)��x�r��� w,k�|y� ��n\�o��>��zoi��k;/��f���*,��������5_�n��m��ʶ_�o����`l���dkilk�p�ן�o>�����j5ī��� ��o��d��v"�/atcdd�ef)w��y/�ف��$��4�� d�8�yᰁ�a�bz�����ܽ�- <�y�oiz�}��f[�aƻ�g����!v�p̑� f�����4f���ߪ���b���i\o�w谈wc?y��1�q �f�s�\?�ڝ& ��%��lp0��a��nޮ������vl�����2���uv��8ef����b�����m�9)�秆]���5�4�)`�v�~]��^yi��6#j�)<�|�����!vls�b�}&��&���z�p���nx�>�������3cft�z�fsvftz���tt�;��o�%t�<�%�[wb5��@��[���5�[email protected]�ta����=�=b�dշ�{���x���ɭ؃�9�s��x�8yfa�#�0�v#�~u����g��kܘ�y��l�–�s�=w����%~��a�`\�~�ӱy� �{��ָ���3� ��?2���^�s[�m � hڊ��a������s�n�t��� �m�#����o:,y�u�0[����-:r��>����k�o������˼,1����0{9���i��)�e���4��.���ȓ��a�6��u�g��n����sr(�zjuʱ��>�p93}[�(l���"fհ���h�9����]f$60 @)�n�5�o��"�[��dna���a&���٧n׿�v��[-d���8��k^>:#ѧs�,.lw���� _ ͇��$���&^�.ؙq�}l�s�ӛģ�5���p��rhu���"*cbii��ͳ��}�!��* ��șw�v�s��f����ϼ���?�v!f����y{���5iҥi�&m�4�����ր̪0�&��k ��o�l|ؿ?n��3��:���ʗ��erqa�v- wۮ߰(�iv�~��,����v��7��$t�eh�kl 3����6�7�75��͙m��w�� l�m��ц�0c�� �kh�˚�==-h}�o]wѽ����5��?���bg���#�į�ס1��&��h�>l�ց���rh�:��� ����=��h��̯�[email protected]?z��1bـ��~87�q7`:��t�5/b83���h���������d�]����8i��3,/��ǃ(�l%r��&�wѽ��3�0�kjda 4c��,�b|�d�"�� pjo|��5ӡ�9��>zy1�����ʑw�-w��r:a��}��2z��0� �b,�v��8��7s���c` h���7m���[email protected]��x^ޚr,e�� 8��۵�����lxts��)2���*~�x��d�d���nǣ��]���܈e���t��b �nճ����v)n!;�8.y���.hĭ�h�:���<ta.�'jf"���>�\'�؟��ar�o �@}�`��'�de ,-���r.z"�lyyq�һ� �x��e���=����b�!�-a|-�t����ns�d�(*'��� ��4����o�3 ���вϝ�{d���i$���#k��5��,y�۱-��~�h�1�ߡ��oga����o�x�&m�4iҥi�&m�[�[���w�()@k'�����$�;j��c'4s�n�5�{[email protected]��2h�f�聨a,�jgs�pg��>ɨ���d\���x]���p4y6����cjǵkn="hҩ�g�f �^���~¯ݨl��8 e%�l��a�� sv3_��v�����3���k�#�x;��hzh[ ��q�av���y�kh�.��edž�(�*bop��  a�pwi� ��[email protected]"@>@3�i�=w;��(v��(1��&�/��aw��|�ءv��m�g� �o� g�ߑp���ɴ����˵m�>{�����s��=1$� 1a�2���*��u8֭1��`{��������ɦ�}7b�� >�{�^��u�,( h������o�j,���^g���b�/������`3�- xr[<na\ݦ(��7�;�1��mu�h�"[,26��u$ �m������fn�5���p�]�l����hs��ּg���bs� a£���qu�t�䉤������e�{�f#����<c3�n�������srp��ɻ���h^~.h�)�x�ص�ц=ܑ;|�b�i�xe�mh$� ��|ntz�9�}ļwr/�f��x @�on��y"����#�@�̽k�y�m_�v�c���lϡ�¯����pr!��}i�t�c��ڞ�v���lĝ焯o��쯈���ua}z��z�y�v���΄x�msq$�i�֙(����w�x���[����u�!����o��� k�rx���xo���<�w��x;�r_�s^��.��"nм�oov��v.�a��x��86t��i ���7�櫶w��ͬ��82�9��|�j ��$ir v�-b�i�:�2a��� b��۩�j������l_��ľ���p���9�ۖw?i#c��xy� �]m���^�0�0�n"dއ�{$�m�d1��k������ja�=j� [email protected]�$��0��n�)w\-d���d�`mml٭����<�s����;��4k�q?�=���?�{� �ӵ��d.w6�k��w�ۃ5ޮi�&m�4iҥ鏨_���l̒o����-yn�y"@��:g�ոc;c�3�����ݔ��ݎ2��̡tzb\��}��u�0�u]y%��l���%[�<�q��9��˜��;�e�0ѳkg���m�;�����'ѹ�����5�^fl >�e�ҋ�� �&�$�]u��$e^�Ꟛ�?`��vf(r��v��'�cbt�w�i��gq�eѱk�� ��b�=������w�;x����n��h�e��xѩ�|橣-�����{w�u#�$�_}q�.&��l��j۸r��㒌 d�ծ�h��q6�g�y�� s�~���dg5�w�r��� ��� g�=`��Šql�@$���y�'�f����ooѳo���-rы � ����":�y�i-o� �j������_�v���� �շ�������a嫘ј��`��&�4�u:�� :@��lp�i�cnw^!��-�}!׸��� ����a9��`��m>�k��^u��o�@c���f�� ��a�9�<�s�s^�ӄ (h�,\�uma)��b��zmz8�i4q�ɨ'k�|�x����j��^�p?������x�ӽ ncm)�2����=�,�������{u�r��ׄf�ty]��&�۲0���o'^�"��o�~.�w���{�l j��zo�};�dңc�b�$�3#���e�����q����j�m?$ly��6������[�/�ֲ|!����i����-��hpct" ��[%�˛t#z������v��b�hr��|��x;�ǣtҩs!����x�p������d��7�w0/i�(r�ȝn.xq;_p����5�e��z��z��.��a�g�g��5wz�}62/!}ƀ�7���#��sdtq���/7�bc�};��=��le����@[&/����.�zqȕsݪ�҈��]f�r<������=v����e�p�xv��˺m�����m�چ�ۏ>r�bӓ�8/��ic�%ׂnhw`�������}��dy^ �v] ��l�ة�l"�e�rc�/98���im����po ��d*g���/_ ��q��e��?��lvvb� ;]z_�ў�ꆅ�:�x�׃��%�r �جby����og? @�h��4iҥi�&m����u��?�v�,bn�uc��}��3�;�l4m�m*���$��6>f~f���e��nd��a� ��s��i���esս����/oz����6���u�7�xf̰}�%@?��:o�ņsw��{~a��,xȿ0 �™&� �����>ʒ�כ�'b�ȥ?��]��=��3o��b�0/��v��jz �� ���t}�q��el�t���g����p�{�, ��w3���{��q���?�?mn����x�n���� !"#i�k]o^/��q"q`��u��9}lq~șh��l�'w{އt�z��ru�x� i�;�_��ws �^"�� f 6��؃@4����g(ߴwȫm�/^�jn�.���(4�9�t�� ,n�k�ژ�eă��������̨i�e���2���t�m� �3��>;h&��c��խ<s�6sm ��d����:���h��ؼ`u��k̒r�"p�u��)���{h���7�hӌtq����j�k��=4!`�� �� 9�աԅ��&=��d�u 梜�&��v��-��?.$#��ݶ��v�o�-5`&p���n��v8[#|�e�1�5^|r'�:�^t�\x�:��b���ښ̳��>0��]��z�@wd�b#8��> �؉���d�@����.%ð�,���mδ�u��c_�p�aws?n ����l�=���) �yޮ��5����v���)2�Œ뱢s�z���{���yot�3:�� �7�jz�.p�,4������j eȧ���#��h[�੭b���^��t�&o��7 u9��1���9cdꄇz>?�َ/�o 4���j��orf=��6�ߏgb�!�yb�c�n�����g.ezyұ��n��0%ml�‘�: �r�̬��ğ� �������l�zݩ����m�2����;���^ø7�� �h���l'��v����pػu{y?�kb�،%�m �3���d�g�ݛ �$�aů��?��=��[��vm�4iҥi�&m8�f�]q�n�:����x�������v�7� ��t�#�$h�u�v�]�gf?=,�g�n�d��i�}�wi1��b���_�����s��7��pߧ��鉱o,i\8�o�bn�.�[6�uu}{�:s?�����h !&�mx��2�(nel�����(x���l` ]�b�`t�w�h� $r �.���am67߽c[���h_� mna���р���9��e�w�o}�8rj�fyh�d���n� ��>��������y�g^z��1�o���;�b���[�^�iniu,k��2��2`��~o�6mdu.3att>��3s\�rwzξn7�q��3![o���y�̮���df @��k!����# ���w�����6ow��l$kd��14a� �qwo���dd ��j,��v�q'@2�6ld-� ��a�&68s4f�ф���k1w��d��݌����,nj��xz��vl᮹8 ������a���^��e������>�[�ι��5����ip��!�#&bu�������s�de @݆p ���;��åwm���r �7�\nlu���f٫#u5�`e�%f�1�u������g;�rڣa�#?��#�`��ـ��)m�yyr��v#b�ha� i����*�s%�ܡ�-�f�8����o�m�7�{�����-���`��o=u-}=�e��v-� s��n����{�oh�%/�� g�ck.�گu������=���d���s9e��}i���n����‚�ܰ|�֨{[գ��e~ (����5��7 ��&c����0��4*``�( j˲/z�>4�u,�j��m��흈w�;6��>x��-�g��fes��:�_��i���x��i��1;�����q�%���t0��`@���e���:x|s1ެ�v��vm�4iҥi�&m�����ow�[�o���������7�<���n]�� �t�t_ 8�u��?��9w�u�@�٩܇{̗j�ŧ�n�x�x��i��mt�k��y���ꛦ;�6�� �f�d�6�k�8<{�0}6zzr���� 5 �vs��%�(�*8h�2�;v����>����n�ĥ� �ib%8��vنe�z� n���iۆu���m� vj� �]ɟ�n��8ݵ� ���������)� [c����@��3��f��e'���h��6��noe�o"�dh��m���q��\�u��o��~d�3���ƽ��]n#-�ey/)��9�v��(v�=�#��g'�9k��j�=j�;�.ִy���-zi��hul$*kv�h�����~��� d�8؏��gޮ��l$�x�����ۍth``�mroby�-%�h1{7 ��h$a��բ)���d�:�)�8���o �)c�q\\ks��n�u}���z�6m�ʃ�6ͅg��y �厒!d��f�=�u�o��q�ʼn���d pa�i�f�a�ݷ�/��~��k��>m��4iҥi�&m��x��� ��q�g�n`� �:�:t�.c��v���[e�l��s��n� l 7�t��5�ҽo�=�<�$2�ڥg��wt�s0�0�o���� �o�/�������3.��8���|�-os�ý��u�\����z�[[����ާk��n5�vx��o��ӟeoo :�7s�dqbe.wb���� w�l�g`x�e"�gɖ�����#o_!��j������o��b�e�f�^a�5�n�v����%�" �wl�����ʛ��o됗8|w�d'��$)���pq���ké�!"��#`0��. �0?:!bxb2:u��˅�=��]k]�j���a-2�) ������cx���sh�_ш�a�7d�^kt x���jb���zo?������[email protected]0��8�?�vn�w�1�_q�_8;���bx u�dx�vx�ؠ�k����� ��d�pw�b�n��d�ٯb�d_��e�[� rn������u-���c�5����ً��b�p�����w�=��?�ttu��o�;=�7bz���r� bc��@@�"�" ��coru���thhf�s���3 ��<��,]���^{͚l˽瞽�ٿ���s�"�c��1y]m�w&�t�@h��(�#�h����ɐmk���蚓e�e�g����>ꏟ�pѷ9�\����uas6j`"`��g��(�mgr� y��3�e�,�f4��xx$ؤ ���u�\�c��=҃z6a�.b7^ �a*��ă�"̻�w���p�o@e��{ҋ&y^��0ŵ�,��� ��!-����ت�� �����q|h����u�l�m[[email protected]��.t*��1o�tޮϙ��v�j�.�,�h�ange����'����b��o�u�9�v- y�9dh�-u�����;�s�|'�w.�ӯw�ӛ�{�۬qf>��ҁ�͛ś���:>���� 7�.w�~�~�~m":��ա֤q��.l=��v^m�5?7��ec��[���qfjüh��=:�}d��]�gi.��'w�yu�g;ybj1i���mm�h:t�u~�k����4��ܓ�#��������|�.��o�t`{���p��ɑf{�!6��>��q���yp� ��jg��\%u,�%_��`^���`6:���::�_n���}4����zv�hz7�e�ϙ!�;7d9 ӵu&>qst$����a�'��z�:u�.zg������}��� ����r������ &��:��v�y�k^�׼�5�=pf׮����r�n����y;]k����� �b7��u)<t�.it���v��qd��6wz�t�f�=)�ft�`k߲ h��sw��^.1���پ��5u�ώ�7�4fa��������7'd�(q�̡�\9kn o����0���-����?z�ak��r�j|l�� �dz#�|��v�a� (!_u� % y�ϛ��4x���ޔ�$[ �a��l������t�����u݌l�;jx�������jz#=hh��ϼ�����n�^�ۓl�5r5��t�� �^�s����vo��=�bd%r88k� �s�w��h��n�@��j=��z��/��r��u��^po0vu!���*wix0h)ogi� �;�>�,$�*4�f��av�����1�<��y �i�>v?ο�f����ae���p�nϗ���g�~\�q��f�1���ax�����i2jf��s���;�łe� �[̮_��o2�b��й���y������\h *���d����x3�}�za�͘�s[~ ������yue%��]s�щ~�@)�wbm��a��øϖ��(�vh����1��;l��i����a���}�]q��&7�l�7t�na|���~��>n���j��qճe�b�n�d=p����j���f�������꛵:o��/8`���v��ݠ�p��:�k�0ܽho��mn����鱩͖؊����m�թ��oei�pp�.qm�ƕl��im��,m{$o[���d��of̜�� ʖf�ͩآyda�ȼv1͛�&eg� � ��_�m>��웼ac�&$�$�➟��8�nwa��'67�ǟr�ihzm[��p{|��os��u`2�o}�����ua� �^�u�44 ��d�33��sw���y#�m���i3��w8�*h6�d��v�w�=z ��k;��#>����o���h��w�w�ϫ��p������!���]-m)b��{qbc�}���ꝷ*o���2w�sz ���j z�腆��o���k^�׼�5�y�k����u���ou����hb���]| �e.yd� ש��tkjh9_iqvo�nj̯ld��f^�;tx�'$?�bц� ��߼����g��������"�kgc�v���'�6:������_�w�j&@��sߍzap���o,x����[��^�u`qqòkm�~#�b}���g�o9*�:��[��ˡn�y�[9�a�|�~rd��{��l���c��qw��픫����zmm��h�y��@�uގ�� 6����>)�^��rd5�#� e@�����p�.=��s��?fw(��� ;����n��q��[�.5h #!��q��icjeo�����t"%�������o�i߽#������wi�5�aǐ y ��il�l�>¸��� �uo���q�j3�z�lyְdn�iԟn�~�t�t5m���y��q!�n9�q�m�����ezo)ct����o�w��������d݀�~���������ߊz� �٘i2����όx} 3v3�5f�[�'���슸t%�8��j�?��a��"m�˙��3�yu��c�i�y3ُ�`���cl�圅s�jլ�8c��d qb� �������}�2�}ͣ��=����nޝ��t��mٌbà�u�_�b��ڹ�?m*�,f��-.y�y�����e���&��t!����p�zˢ% -����mz�ӑg �[email protected]�k;���=9/���g��m�y���z�iى�g�.[".xdzyc`y��ufe�x�[�.vei�ˀ�@,�c ��6|ut>��(o�w�w�v�pn%��q�f`� �0�2�-�����𘷊�׼�5�y�k^����~��1(. �j�;r�c���#���=����c7o��%�tg�u����ltʬ����ݿ[��s�����g�}bw�,|~pv���� c�^��z9��%~k�rjn>�iu�'��{�?$��5=�%�˙! ���ۼ�5�|�c�%���㾷�έ,�y����5{n��qa�lly���g� ���忼^vu��a���]�e�g_���-#mˡ�4��� @vu����]?"4��t鬧`�^a��72���dg��h�y��}�ƒ�� ��ħ���:d�r�)��@d����zl�"n� {k��sw����(�]1�υ_r�o4n\�����h[email protected]|@1�!j �b��q��%�7�`f�0�x���_���~�k���h�q�ѯ��c3[��/ ��t,�k�z���9�����kd� &[d�sގ�g.׻v`��t3ڐtϝrךv�v/ͧ^�9>p�|@��ى9�)t�*ޣg���y;�鱪 ����s�s��g��۵b�'�o� h��g�]� ��{8<��_��oف�\w���t����5hƴzܺpk�u\��/���]ގ�{vm�,"ĉ������p�p� ����ӛ(v<�ݫo�n��{e�o���}���}��o2t#b��u�̈њ�ݜi�j���z�;��#��fogϝek/��o��d?�a��ix�;��id���z;�x��p�p�����p���s/w�~��/�[�y�`��o'�f*k�b �qk̥e������t�bc�!�вtw�)�2z�s]��s�d���d��p�ļ}���3q�v���`ײ��ue)o���a���-c���� 2qގ�����ӝ}}�z[oіp�nȹ�`����5���b�u�\�������[it�6���k^�׼�5�y�kw����\!���#p�w�tcvp<�����'g�ԩ�p.��j�� �s�kοx�w��m�gn�!��fѓs�޴�q��)a�z�|�?��ԑ���#3뚻w x�^���m���b���1|w�k_6�~�v)q�&mj>�\�gg6j��o�h�iۺa�΍۶��.?�o��� >,�gǵz1�ia�y� =��t,l��4�ma� �ھ��s�z�-rpf�8�1��"p �>q�3d�l1h�n ����t����m�ԝ��z�m�����`��!�j���[���^%ݤ��&�bq���vv��2�#���y"qny8�`f�r��� �y��k�z���ボjσg�-1����e@�@@f*�׆�����>l=�u`�t����nq��&.�m����ź�����ӣ6i� ]��^]3}e���&.,��{z eb��f �u�%�����m}g�e:����8�äw g�j5on�o�o;ur���­���^�k�n--������rg���w�����? n�n n�)4���h����z��/r��;���e.���{��4�_�kj��@v#e�t���l��yѧ(�^��u�ԭ�ӆ��] w�qg��� ��l�:�v�h8�a�y��b�hq��xѿkuٚk����. �˖�-� �ɑ������#���a�rx���1�k��� ����~��ǵ�l��}� #k��/��<�>lq���}�������[3޳�/mwb�r^��!��l'����`�)��y?��k%y���;!9��k`{���r����x��b'k/]lej�r��37��8����sdª�i a��@�{���[3�[�z����7�c� �c���we�hk&�w�.xz��3��9�nl�߸ds�6��*uީ���� �>elyv�÷ ����/��ޜ;cj\˦���ܴ%��.�,����?-��4n�����8_�)[email protected]`�q�kήtt���������b�k�f�~gxp��?ث5��cצ�۫�ź[��0�tĩ�t�����${���� �������n�v����-��*�2#���`ta|s�z-�~b~ ����7�3'}nn�p�f^]q���ɸ@s?r�ީ5��y3ә�m-c��9�����/}�4�ӆlr�ȼu���y�4�>/�b _�=n��q�� �<<`��)c��{��r���̨,g���\,����z����m��vo�k�z d��j?� uq���=-'��w/��:�w�� #���b����gۋw/�h�qmd�k���i����v��}���2uqwnυ�9m(o�k��@s(v�]��7 ���2^�׼�5�y�k^����~���� ޮ�-o���:�ek^��i�k��{�sᮗ��xӷgdz�!#� hm�oo�jdhj�ڷ1̝�og���]:;e�8��a�͊�o�e��ă����͚� �\b�1-�t��51�t����@��a/�`�kfʈ��k�ɇzi��xk|�9��a�t~�� r�mܤ�tu��1^n��y��>ގub�.�~���l�b�{q��<&f ����>ޮ {9��y�=�o��uz&#:v��١||��[���ۗ\��{(�����"�ի~����l��a��qpqx���i�y�a�[�m ��u����v���^��k_����t�� �q�fx��b~e���6��k��8aff����%�f�˸��c}��[�y���c%��8}��œ>7/�ۿ�����c���>�����&�3��������?���/|�� �� o���v���oy; n�*ubs�u0�.�*�^��^[email protected]ؠr�ĩx\����5�k�54�շ���ʔ0 �3h�צ�b���ƿ,����k,�4}e����!~���,�i�r���s��q�'��rz2�c}�<�悆����. �?�۽�uh�ahn�]���!j���ߟz�ys& yh�b��� �p ������b��t\0��u[�y������dīy��@ф7h��]3�k��7o��bp��[hw�j�0�d�w� 2�|w�ox�՚c��w�`nwh1 j��ty�b�x˙�@l��jel��v�j_�8�敧��>qlj�f�>��ߘ�8�* ����b���ӹ����e��n�n�����2/o�?�۫>�!̩��ze�b�l��m��kg�<֊�.`z̬qt�k�d�ku�t#oodd�bzh\/������ g�xs�cee��4�i0!�a*�)�l�n-��μ ]09�]vt^�8w�p��k�^�ԛ�ɏ�2�)o�y���m=pkߛ��z��y�#s�}� ��s�6� *����&���y:�4mi߱"}��zo��j��q����� �`o�d4'.m���(�t�o�h�ofz<μ���#z�@� �}���`�3��"bv�_�,��$iwa������vو�~���^��`���ҳ�н� o�� �v�yy�׼�5�y�k^��|#��lj�.�� &z���z�bv��u�=�^�k�`y����en��rw���c��&�� ���7��[����n�a�]��%���ٷn���a�f�vf�fv�ӟݦdž�7�g��k��� ņ '�?�7�a֮�6ocv�aw|k��ﺍ�5��ue�כ�c���rˑ��[�o�p۷�[60��2k�ů)�n�n]��d��wp�cn"��bx��j������i �2 �#4�!?vg�r������j�������9=�éږ2f�yp-d�d#؂�ag�հqw��f�,���n�:a,�v�h�#��c;�[6?k_�m�v����~��h �d�%�h(��전�<^�h���y2�����b�l��z���s��56�b�s��&��q̆��5�8�]֊}l�po1��8�h-;>� cn_�ȏ�^r{4h����%g��wc�e��"ۣ���ǘ�w �׉ak�  ���dup���f���h�:��;�i~ ��@�r��}7o�t��t � dv;ќ�����/�ة*�*�j���d``x^g�v�̚�&��`�b-p;oo[�r�����ɯ�@�pw����n�,z_8p�x5w�.�~���ol_�٧ڀi92r��������շ �nf��f505k�΢�%q*��l��j�� �*(*��xwi��[���߈�򞰷$��qh��q 's�nq�!w� w�(��ta�p��ޏ8u�o�섈���i�/��oj��<*�?����/�u���ps�z����2�#p_�?3�m~���� }fq����p=�x}��s�ѩ�t8���xo���d��-t�>_�r�?�������r$�����;h�ik2x5�*�t�~��e"�l�ȇ�/�!��x�_og���f�a:̌��r�kp�p at� aa}�p �w��1~�s\x �dou�d~���۹�o4 �!��܅ v� y�e�p-�¹�y��[����>xd�-i���p68�)e����,&��u����9{*��v�6�kϥ�0>9���k#h 8��aňlǎ�-�g���ձ�o*��g��^���w#�0r܂����`�� �p2��q���xy[3h7\үdw�i�қ�qm�0����lb�fl�4j�ʹ� jb5��sq���6�gn�2��`�4-hxkw�0���@�����)���5��>k�����ݲ�7s��e��2і�(�rz��s��g�z���]c���cw/p��׼�5�y�k^����~������k��󨊷�j��ժ�jn��2 !nŭ �d .d�t|\��$��2����d�k1k�����k� �,�nvr�.��'�}f�]��s28]l��)w��#%���> k��9]�˩�%:u����/�qj�%�)b��pt�ox�m�=��o��"w�]�s?��<(h����- �u�.���dsl��w9eۦ���4�a [2�^b?]�:�s����b���g��r>bltݴ�[/>ڍ5�fcpa�y_y�^�b� ��2����ݍmjs�5���#�ߜ3���cdb��*�|��e�� �� �ٓq�h� �m ���"�.�{!/2�1�e��edi� �:1�y����.o��_���:o?nug�����]i1i-w�vmjd"�v !���� :l������ 6���e�s�y���?�������o��n/l�a���[email protected]�i��ap#��k�c��4��%� �qi�=5%"0l��>휳�w�y� c�/y�õ�{�f�y�[�z�~������x��jj-*5q�'��g�)?}lhp��՗e��{b �|� }x^kݴw�\�j��ܨ��a�d�n�~gwv� �jss�wl?%<�b�pu�ï do�v tmޕw���9��?.y��ig��g���������~��[{f�����5����ħy��u�2k]���ó�� x�hwe#i�w<�=>��ʽu]�#�ⱥ�� ���=��;?�*�0k�o�2({��{����� 0���à zb���k��]��˔k�d���o��jq}zgq���n5�#�?[�祹\w;���9���.۳���n� ��{h��=��ak��s}z�,���u�ay� k��ؒ�����v��~o'��kq�c��\u��wpl�(�$�-�g�hc�k�)y6]�=q�r{��릷�t�jd9h#�i�ّ�9�@�a�q��x�˜��:��,���c���~�g�]���w���ś�{�e�n�k���ո�nxf���c�g'��|��h����� t��ů�4�k�a��aն;̹��꓃��>����6�n,>�~�z�[wm萊�~�ʀ�b<����nˮ��x�el��~���cu��h�`)�٪�3lp�8����7��{j�:e����]^o�� �ؖ����l�w�^�\��]�� �3f�va��fdͷc�h���;��gp�s!$�{&�n��6���� ҄h�f�ޞ��e,c�x�2����x;�d��o�4o�:}�j���#�}�'-o�v��"i��(a�� 8���x��e\.�\�a"к*{� sj0��e��h��$đ�c�b�� �bdi��6l,te_��̟�����i�1.ɷ큮�`�[�����(�.n�kx���r�vg�-�&w�it��0 �[m��r��%�/�=6 j)��������;�4 �����i�.���2��w;{����o�樵c�o�����h9� ��������sxo� w r4e1f�}���0�`9&���/��3u�e��?��������p� ��� �b�}%�7�^1!>s�z�o�}�����v���u��������rԦ�4��"��h��]��8��s�, yi};�<r ~�3�}@�y��:��fl����t�y�}���.�{�p2�y�p� yv ٬����rf�g�ќl�� �m�u�o|3�ja!?�����kc�z3�yሁ�-w��<�h-����{k�� ��%��s����z� ��#^�u�es�>5z������_#ͭ�c v*p����v[=5o�pe�5گv���l�^��v��s7������f���`��s�������y��aa<�&e╵���m#&�9i������q����00x�&���e�xڶ�uk�k/*����� � b)�ԗ;�u�tro����傍kk֜�;s�yɚ��o���{����h&q��7�8�9v�v�ȿt�w���q�x�����s�fy��d�� �fd��ۛ(^�r���h�=�~�� �$�n�qtj)��of��f����ӫ�n�s����>�_esg���ԡw�=�s�ao�gw�t���� �8�' 3o�m����gso�.( jn���5ާg����];�)-9ep޵7���,\g����!�_�w|m�1���7�_[email protected]������ݯ[��v��e.~|���9����q��7��c����w��ǐ澿c���lܲv��u��3������[iۑd�������!�,�`h�굥[^ <���*$uãf� n�j�<���o�jb����i��[�d�h���'rfkri�4� '��?��y`���e痽�z���f!�al�ǥ���o7� ���<���%�b����=!x{�l9]��piy���۟b��-y�};;����v����x�2���e,c;> �6�@�uec��d��&@�w�v��a���|.���ӗ{���n�悙(�&d�� ����cb.�m0���`�p>h�f<�q��ra��n��0յ�(���u�#��2�b�^��u�tbu��[�z#<�l�w#��ђijrd�����y3�v&��g�ڃm� ��f���e��oo���m��;o�ہ( ps��#r ���en�8:at tu��t�},�ny�����6��x$�����>�gg�]�' 1ծay��g߱.حr1#��ƴoj�t0�cő(q>�}�}�pm� �:��g{�k�da,�h�����w_�\�0pr�^]�l�\����/~��@s �!$z$<�i����l{d��3����t�2�z�����wk���?ax��#b�/�/�tl�^'˶w-�>g�x��h[�|!x�\��nڏt厹5"�����"���2sr*��4����gx{��ݔ�fi����a��5��ta����i�a a#�y�r!(�"r�w#[email protected](��@���bw�7�o=y�d/�s�bڬi�;֩[6)[7k�nֶnѷ>�l�y�7e�.vz��s'ko�����:���[�&h֞���3' �,[���c�ó��6e=vl��ʥʏ~�<�f���)ǻ_���� f(cf��问u�ߨ<�g��[�-���\yv|�s� e����ue��~�؍�0w5/i~����u�c��ezn��[�l�k�zg�w��� dc�ɘa=xq��a�����x{ւ�kbue�]sg`�ke_}ͯ�`b���<�ej�hm�3�ܨ��h������8 !g\sb�>�~������i�������l��r�q���{���[email protected]�u��z&�h5)�a� ���v���hxmne��?ՠ ��l1l$�o���#<��o��0!�e#�k(������㟷�;.���~��ˊ3�!q�sup4j�d�s�e�przk��w������/�xq��bq����7 x��o�y�ͻq����2u�t�v�����c�m��ӆ�1mq��ʘ��=i;f�e�#w�����sv�"e�"e�m���m�>x��}�����*��k�?���� �{�w<8k����� {��<��|w{�>m��g��da�]we��c��g�q�p��=ue�}oi��)���l��m������~ޫ���}ɠ�=� bj�pe�5�� �x>��f������s[�g��o�e�6^��^��=��#t��c��0 lڧr~> �t�[email protected]$s���g� �o���/�!��[�jm���{ a7(0!£\�6�����>ӏ鱗���e,c�x�2���}_[email protected] b����;` ��\ol~�m�� �i����ۉwl�[2p��*r*ha�/��.`�%)) rfp&�|mp��9 jm� _c�d��k!%��am�i��%�'��ҽ]�z�0�q �[nķ �5���<��b��)�;�� �y���!���"n�nޮ����=�̔e���&��:� �!�=�dcqu�imy�]�\ui����� ̧���i�cb� ��[���)h��s�!$*����ŧ��]�#rv)����� ������y�%�nvbo��w.����5?v\ͩ��{e����psbxo?6����ps��0�˃��j��p;��&����� �bh��=ow�.^{�zw̭�/̻�jε��. ����� ��x�1 y e��s �ţ�q�/y���|�zz'/��ja8 fƀ���^hh�|�0��`���. ����\�]q���#>�olp�pm���}���enj�o�^�"�����і���(���du�տ�$����߰60ixhpiޠ�hߪ��!�e #=���z����m�6?^�~]蕭���e����m�i��ņ�����98�6z�9�-[�u a=�vv��55���gg�����-.� -�wt�88x����o�(3�]"r���� ����f��gj �=jc�b=�g���y�,ϋ��j!�b_l$fõ��> >�;�ֵ����.c����d�a�y0z����k�e /���[61��jc���ώ�d�߸ b�b��v~�uٰ�p�mxh�dea�ƨ�.���苸ho�i�� *s�mj�x�v$�!y{=ŋ�x��� ���_c��y;�*[]xzo=����_�;�o{�q��<��r�g �s*j�k�� �]�&���f��@@�����j ��ƛs9����ɣa��ٱn�hui`�xs��ƴo���vz����y���ў�y=�ý���.�<�碗�/����}bj������� ��=��-�`��{b#n���������o�v'�����o��==<�*zs�vn����n�?��������i�_=����hb!mg�vd�&"%|ۥ�i��ڬҫhi�he���u����{f �ur������^���>�ѿ="3g~�8�*g,�md &�/%]�*>k4��y���4��x=���id:ea&]u �fz�do�� �$�-sb��m�χ b�ým�����x�2���e,c;�l��|w���f�f�- ����bx�\�^�����u-�xb �9�����hs�ƅ���p���w��)%�d>i� x��b�l`%ߑ�l3-� �}��|�f5��'�َ]ms��s%�g�e<�����3�a�d�"h��ą�;��cr;��|%��,dz��h��1\ޝ���t�@'�����i�b��x��k�/�����d�yfb���{��^�� �mz�����}�t��m�mۺ���b͢|�:_��}�ݣew�����|�p���(�2(7[(�i|�� �*w-�ti����,y����v����o�ȥ��`4�vv�����w\z~ޔ� ��b�i3w �xȣ�{o�r�l�㡂v�ǎ�����o�*�a�1b>o�pk�}���` �}����ko��n;o����},�}�~���c��y���}4*y{vz�n�a��v�~t! �q�g��b��3t�� �8�g0$qf"��yn�e,nj(ٶ�䧗u]1���y����b��s�.�1h��ڥ�k�o4sz�� ��^3�kk6�_���r�!!d!�����[email protected]�d���yak���^>f��s�>}��e}n����][i���b^үy��_�;�e!��w�=~�e��.�2d����}���_�{o)}(brh�n �v�����/t��ս.��ɤ���^���s�.\r}�/���a� �*�w4d�jۡ��μ �v�<�����z4h���������_�li`�a���`��%_~f��-��sѿ����/d4�c*�^ �� �ӎw*n<�߲q�κ8��v��cż������� �������c?a �0ja\z���kk���$o��;�$io𾃷8d�bv��� ���z���v���?��g��ގaft⪔h��u��/7^��df�y�o:k��s�����sn�`nϫ~^���y�$[j�僘�rrtg��l ����w��b��or���׬ �բ�zk����6oʺ���� z��=t�ڙ�{�}m��߮|��n��pn�y����r���#&����^�7bs�y����7��r���zhk���&�-ůo��'�v��w���u��ᕪ�wu�����z�y]��i��/�?m6a4��-;��%b{��m�e��v������ vy�x�ҙ��q��i���gɴ^ ���7���im�{�����.)�yԃ�a��ġ�ndu��iy.�%܁eiɴҡ������o��k�,���t��o����,����7x;���lq?2�h��x�2���e,c�xǝ3�������<�ll�r���4����i҆t��-��vw�k��p�\ yz��x��3ms`v�(s<�x�ai�[email protected]�x�t>g�`�d�g��w�de�3�l�<� !����0?*�az],������*���=���8ճ.v�ے���|;��#��z�bt��jxc]��c����}���tę��y;�����6�t��� �_>k�����r�g��^�qch�|ڀb� �����"u (jd#�a�/1�7 lۿk�h.�h:��m�f��d�a� q`\�q�������[i �=,@�c;) -��  �z�&6��=�8�`����8�vy`�p�dn���k������ g%gץv}�x�ujv��߃=ҟp�$��1�0��b��y���pi���7ۧ[���bx�__��ۥ��w(�f��^� ��[#��p� 9ϲ{8,࠯ osra�xh��bw�vxb����a=��kݻv$�����m,���f��)w��ɇ�-��l�[�ұ�������7ԝ�t���aes�y�/?x���yu�u����`�� pu l ��s\q�2���n���՚����v4�,j�g&�@�i��l��r[email protected]�u �e��%��6�o��;]�t?'�4�s������c��1 �wl[������tpm}��/;�tqc˔����~�2te���:q#vku�aj�~q�iys��c�wlx�غ�q��!f�e��&qt�⿊1����`�r �qb�pyѓ0� $q�z��zi�k�ε'�t?�r�,�g�c���e��mީc ��з w0�o��ۥ�y���}�p��sʚd��"<�t�v�q#�\��"d�o�c�d�[]���;���i /��<��`"�9��9q������ uk��פ�/m6]�r���9��^m���"�"@���p-e���pu��,���2�9p������g�g��-�dž���vy���dӂ�ս��5�;� :@�6y}����������e �?<�xѡ��ns�av�s6[gh,�klh�z:(d�z�3�m:�����mg�o�'ʟ�os3����n�d%x�f�k �3��"��h�so�>q@9����5�� 턬�����6?pb~z4y��];!ƀh7`�nf�np� �c5����y�on��y���i�'��2���� ,��e|�~����4$��đfѷ��-��[��2����ud� 3 �`o� 4�<��<�j��� [email protected]�*}�$��m�m��c�x�#�`)@.�0xi^g��0�aa���q���d�[>�obp�ѹ�"-,��b���|y��j�q���n�{< � �#:������aii%ґ��s .f\(�� e�3��vy��]����t����6u����,�r�噜���^�/�g�����-o�%������dv.72�g�l�ŗ!�?� � ?fg���r�1w�(�����s$�$ b_��v(�]����uqndx��x�>��#d�9�2~�(�����qg��ig������a&rc��q���tg�!�c��l�)��d�͒�\�a� 9�ɓ��v�@�hit\�y����a� �ɟ��i�w vn�� �p$#����3�6�0�������<3�d��d��s�� s'"s�p�"����o�t�k�|ž6����&w���èmm�5\[email protected]��w�����ч�l;<γ�d�<6���#�(�;^�����a6�a��d#�u��[�c��[y���2���7���ds��*���ɞ`�w1xዴ���y�'y;s �k�:fč$��3���e,c�x�2v�y8sx"�xg��dk �àu�����r�ہ��6�n?��ѣ���l��b�bu7�b�(x�/j� �d�@(�u_ǟ��bt�o��az^�аǂ���tba�q����r정���bf���o�l�kx�a�a�t��� $�){��؀�b�8�4q�n���{���*)x{_�����t�p�� hd&��� ��d��;����� ��wdg�ș�{m4&j���:^v��[!���e�v�r�t�hhr_��"��� ��u���1�c���5�c�0� ���a�|h _�$s\~/�"lu�[fi�rq�$��#-z�a$���� ��jڡm}��d�����q����2��֫)����r~��&�_�p`�gi:8v�|o�ўph[���[�v��j�.psվ��$���,t��{;o�rt�c`�qŧ�����lq�y��,ƭ!�w4,�7���>�jc���([�u��%�b�i0h�7|��ɏ��d��� ��y�@ؙ��8b��o�}1v��g�7i>b��\��u7!���a���u�>b ��s��\��mr i�'1�,�l�w�g��g!.�¸sd0���~s�an�]�r1����>o㮧x�5��^(�\���\�1�=�i4�<�eioơ� ��b��4l*�@�&ƥ�\�q|�}�v�����&��h���e�ĥg�򁡷���p�r 9�u�'$u��kt��ӕ��þ�[v]��yx��7��rlʔ��e~ �ď#k�vw���j�&o����lk�l��@qtrt� �bhh��(�h8�bʆ@ay�w���zyk�s��!�n� �u��n�w���k���-��u!�o�72��*�b�^x����"� �y9�g�c��{�ӭ��r�ð���-�&�e�.��瀃��\i9�r��^`?����-��r�7(̦��%ʌ�7��k���p�i,�r�m��p$�<�[��er!il�`<υ�z��z�x_�2�6��3}wl�r����/�s�z�bo�a�3���juf��i��tu)eg����u�s��.؛�|��_��70t�� d�c�0�t�򒲕�q񮼼��_"k5�/|�u�kh�ef8&�x[�7|{c�5�xc�5�xc7�}}|�w�ʷ�����c�?�;����syo'=��d�$j���\�o��=| j��o�� ���;���ޗyz7 d��탊h'����5csv�m��� �؍p���"��~��n��w�0���f�v��h/پ����� ����5(�.ͮ:�u�mh9e�g�f�nn3�y��i�w�)k��3;ª� q�w�vn!�|q,cm�l�x��kju|{%-� �y�_� �l9�t��7aq����p`�~����)�l�<8]� דo�'��f?d�#� ���=?��=�2� ŷ�{o~��θ�k������rw3t�?�#�5�v�!��e|{m�qŷw�o�b��k�k�cטy��!�$�� ���{�o��(a��$$�vy�[email protected]�pk�]~�!�-�4�)��w'�$a�cjb���*�ž)�� ]̐lywʅ9.�'c�z9�r��it�һ�k�v����n��꠸<��w���s�3r�� ��c����mɗ��b˙�����oo��q$y�[7�-��� �xn �宛g]�o�_�o� �_!c�w��e��yፃo�o_�p�aܰ��[�ۥ:o�d*_yt;t��<�x�s���� f���hrxrv�drdƴ��9��[�ȟ�\��mgs��ig2h#c8w��z�ls�pu.�f��мz����ӻu�z�$�%��"��@����:��l��$�:�=׷ s���|)h�l�@�r<������,à�������[ w�.�ވ���m���ķ?���yw%��6|{c�5�xc�5�xc��p��_�oo�.�`�� �����*� �����gr�dt~o;^妢<ǿu=�e{i���o�|`�4p�)0��}5��� �z�?�n�vul�2� tq�z٣)�3!<~�z�g�����\x}�[�s���,�ۙ���o)�n�-��������o��ci����fb��!��b��p!�zk��v������朿tu����p�cq��[email protected]ҡ�%߮�c�y�v�y���818d��b���jt `':�j(l�����#�l�$�&z�4� l��b�y�c�t�1ݠ����ɓ�8�n�&���@a�\��z���;�1��_z� ����$7�tx�������)�/��� �rm�� �3w��b�;߾ �����":g�w��:��ӭ��g�wַ:kpy�j�>�������}m�^ag��֑[o� _����tc]e%���_�p�6�ޒ���6�ء�0�: e�a� p<�yt�%*:a�a�j]�; �(��ӌ�令�a*a��q<=��;�j��� �nz�vi���pb�iv�ǟ�m׻�撈�zr�s�m�[%��xn[i󶒍d�ޛ�g�n��48�`�y���{������q�fq=�4�t�d��>�$?���:h�c �.�8!� �0�8<���{:z.�ۋ�.���j��?a���y���\�ff��zmik��l_ag���f�]��wow&z"k��� /�� �g'rw)0����q07f;%ǒjid���i~�-(�x�ag`�wrl3 �jg 4��v��m{�ڙ7}�� ��$k]�x�ԗ,�������@��6�5�d�s���}��s3���g�s�]j0�`n d��ѭb(�w�m�ʼn�c�a��j 7�8tle�3lu��ɛ6�*߮s��ij���\�m�� �0��v���m�<*��n'.~ 7���?ɚ%߮~^[email protected]�oo���k���kl�u,�vtӵla)r�.d�#o�^����y���<�(�;���� r}̛�!�d��"�te�xs�� t�� ���s��*��-�t�r�id�v��"�1�{*u��@p���f��me��&����d�i��n�bo�� b�"fh���dz�8�����rǰ�����:�#���'�p�l �f;hμr�*h�&���fddc=����s�*�g4�4t4�4��gۢ�e��^�����z(d�&e0п��qw��x�p� 4�r�m��h�`:��s�a�[email protected]"�uo*��~��żݲ�b��ld��b��}�cz��c�����{���?��ȗ��ezf �|ug,$0�k���`�^l�9(�^�8o�o�~ dg��x_- �������a�i���dcx�b�r5: g�z�e���,s'uuf`_}g9���i�(#e�5�u�ɩ�iz���a���� �#�ᴻa�*�e|s�ho�!�;�}��oe�ɋ�_4�:�e4jii ;�w0[ �k�h,7���lm�ӽ8r�a��e;x��"�ն|s��b����%����h��|�8n�*9-�i��m�m����,���o b[do&�f��j< �����542k[m� �o��ով� *�k�y���j�� �'���?$��_�1��9��&�z[��9�����5�xc�5�xc�5v���ɷnj��� ������������ܭ��:qy�v]x:w�\t�^쮗l�껱��n����z�Ԯ�����4~�i/"��e����η�ï��lr~�y�ܥz �2��^��-��� �a�&p�[�� ��gcgs��3❻hx[k��6�\a�}n�n��;�o/e�'�\ӷ�6&z��� ����}������eu�.#�zen�my�.-z�����x�1w�|)m�x�o�mug�dt������5���]χ �#�m/��|���x��� ��ɧ�y�1�����#6�.�h�!�yk���oģh�6���> �(|{�`ŷv�q��7m��w)� �n�@e�yo� �o��0]�%дo���c���/ ���m���j��1�)�#����j#^�ow���:�� �oa�s��a��gp5�u���;ʷwk�} �6���b֏_���o��u�u������vhk�l��z�_$jo=��qaj-^�.��*qy��l��wt��� �mk�����q���̻���h���g�#4�k��-:x>�nsr��-�!�z�z�� �d��{��j�[���n7j��w����|;`� |������{�cn�u�v)�=r��ow��p�a�/��s��:��{hv}y���8_�0�o/���cʷ���o6���e�'�5|�~��{j���u����oפ����1���8{1�"��iq�e�ma��b�n�~�f%]����a���2��6�ʷo�p�m�ۥ:f,� �vg��u����h�fzv�o!�~g�� y��0��o7�pħ )*�b"y��:�|{�,zw#ˌ�fq}m���7s��t~����y����kp��t��[*�݇@�8� ߕ�n4����d�� �n?k�̀4��ߎ ��xc�5�xc�5�؍mk��*��k� q��!�jj���r ƍ��т��rj^z����6g�u��*�dɓ�!�j�s�֎*��?����o�\��s��p�/���a-�t����8��me�wm�bŷs�b���w��<�z�0&����h�c���7�r�k*�vey{���"�x�.;b�op\���%�ư�@o�ڜ���o�,e����x1ca�d �np���zg�~rc�r���fܿ���w�rq/�cˎ���"��li]��n�'�q%��!�o���]�;>[email protected]�t���t� ���yei kr ��ݭi���~ ���܂lin2sx���othf>ys�p=�vl�o���"��(�q���pԣ�jf�m�š0t �tg��y��t<����|bo9j/�����0�{��u�ro�)c�r�`��a�]��&�;��t�^�ît� t���g�o|����d�`��z�m�ԁfb�v~y���&p�<�����m�����x�~a b��w��o_҉=�س��� ߩ�w��!������ׄǔܙ� �mm��v���ip�v�f�n���k�- ��@���6eh�֎p�c j}�p5u��k�n̊o���k�2�|)�x��b.�&�����i6��ѩ���^8�ȼ`�uhv�e��n̞�ݦ$�bzj���np=���j��r �t��f�:o���q��8y����irl&����$�r��h����ꊡ5 |?��c�s��� �y{mn��{uly�i��#m"̐����\s�%�lm�˭�ԍt/ug�f���)�`�%��e��i���\d�ո��%b�x��[email protected]���k���k���n`��o���t��k!ۅi��o��o��2շ�ѯd�v�;sx����=�}�z�w�x���������!?�a�oխd�{_���w=�jq�|�s����pw��n�fy�����^�eu1��wۢ���uף���o�t?�rhkp��u.�q;�#�_`wd~�[(�*nr� �z�wx�k�����\spib�{�b?�oэ�'���� ����,���� �zf���_��x��f�r�pz��at�prf�ij�c�co�c`�uzn][email protected]�n�@����v���"z��n�˃� d�s�5rbͷ۠qu�4.cv^��wl�a'��p���0�q#�͂6�ģp4d�m�nq42ԗzi6mp)jw�3���l/[&xk�: ����n�_n\[����j��%��.��di��x���u.�\ sb��h 8v>�" �0ꄲ��b�:db~ ~��j�� ��w᮪��b�.������y�qq,����y�/j�tͷ;ǟ ��·k ���s�_�,q��n.{-��1�k�tp��.*��<�=0=������f[�5�� ���a�� #�s�t��k������6�l��~-�}���2� ���t�j�c��2,��tiv_�z�!��q��_z�r��݆ ���묵�2)�� ��e�j��_!�%ym�az��5�n/�y5�_ƚbeav�(p�g��w�9r���(�k���k����amif��-�w�@�y��߳�uq;��t��,����������»b�jj�pͫ �hpr^�u��uv���k��g�"���h�u�w�?�j��"{� ^$���e�bu쫬����~��o��û�;ï?(��~[\-�|鏕j�d|�g� �ԗ�_5�q#����\��'�q05�ch�jή����o�����1uy �0�.�(�,թ=��#p�|!�<4���'�ّ��}�`9�;���.���� %cp�im��侣���騋u�\.��ւ`y�h�yg�;kz��n�)��z��y�}9ͼ�ݪ��3ua�f������֧? �3�ehy�{`m����2���l���k���k��ԗ|��m^���������mt��kىծ��mog��0<�[ 綝x7؉�����cņ���ڑ�}��4�m�ako*���o�y������ă��p�:��x 3�rd�\�2�/}(_��e�� ��:�kd���o���e�z����n���o�grs綜=��m����\�[jw������o0xk��bra�t&_�[u�j� ����-�ԙc��՚��;b�a���ˈ!בg�'q;ּɚ[��3�7gr9��;)a\���x��ay� *7��yy�y�7�e~�p�0ˁ�?����͐���p�[s���4�i�3�s��\k�1`@`��k��8i`kq�#ύ���k�?$�%0u�2�]��s�����]����p^��;8�o[����7 ��c�ad�lk��)�@a���2�z���u��v8�č� x�s�nr�ql0�� w��~��!�|<���mr?k�n��p0���nm9��xl�lx��s��� ���l"?]x��ԅ�.�����7/� � ��u�no1�� �m�;��4� >�47���6�͖�w�q���_u-#`�^!>h��վ��d�4l2،p3��\nʡ�#!��f ���.�d�u�h�{����g��s�$�:s��;l�ap���b�[i�< h/�ɵ�?3�8���3q�e����>2zp��,��ⱦu^��yq��? ��h_���u���j�18o�d|���\��'���49�����t��^�ғ���hez2 �nսfq�ʃn|i~��d��s{��i�"��xr��gj7-ޟ,m����d��4�=m�ˈ�;��t�i�iz4��j�;���$�ki��i��8��q~{��/m�0�������ez���w�ӯ�v�����49����c���(>g����erf����,����~{�s��b��(:���m�γ����k]�x=gǒ�x���q��ܥݧw_��<�e����h1��8�|;v�be��h�� ^q��v%��1~ߙg���k��ev"��k��iz6n�����<�hrvi������yzj�޻���'�x?��1��j�g����?ů��<&ӻ��.f���{��"qvƽ���x ��y<0^ph�_�����|�`��p>(�����/eg/e��r���� ���䜻@nto�ܗd&�cq���|@�͢�&���o�s��l�]$�_ˏ�r�����yqw"�sg����wf'��8?*����y~�*ύ�)��3f��r��f��� ���}��*�c}3�n�(�g�b�)�ݙײ3������q����jq� �} q�s�|v�p�(��r��݂[��(�#��?��l�,x���*㻒��"9����y3?k�|_�2�3koo�;��`oj<<%a$�^�|0������h�r�ӣ����{�e|u���⇳�?g�瀥l�avf��_�$��''��af�g�l�g{-tg�z�1װ�/��g���,n�o�{[email protected]�q�0{g�y~�nqt���yħѹ,�'����yr����l���׊���c�|��oy���"���q|����t��8e�dч���tq�y�.�g���y|�r� c�w_g� !�d��w);�zv���"��n�u�gs���(?&�8y2�hsjڜ�)����oyy x��%�by���!]�=�nxl��x�o�s�f���hbt=�$ey���9?5o�]�?����y���a�3�x��z��`ϑe���5�xc�5�xc���{�:��_ak8-��^���e ��s y�h�����?��ϥ�}ev6o�����#y��<�`�<�'�'|2cdoe��<~6��ɓ�����y�8̢��3�.��y����gr!��o����r�x9�z�l�<�d�>[�oه���o���,,�?�伡{"���->����7uo��xu�wp��z���|&.~l�>'i�t�c_lӧ��if� ���(��3� iz1 ��ɢg�����x^��˦�}�i�l=�d���y�d��k� q��(�t��/e� 2<�ǔ�$;g��c���q�t�~ ��%��i~�ƹ${�o^䏤�#v��u���g��_|�x����y�m~�?�_�[�1���4����,z1j�������e� w�]�o$��i���{6�#_�d�����u��a���a)y����„sbdhb�ők�h�q����h�����n�l�?�fϧ)�ci�<�4�h^<�oe��p<�.��{��0���j�?��(�2x4>�-�$o$ɇ��cq�4tʃ�)f�>ef���'��6�q��x�b��.^��r�����~��~*�^^$/��o\�?���_6�}�>�y*ʞ�0%ב[�'/1vӗ��i�1]����b�x^c� qza^<�[<�[<��?�h����� f��4}l�_x�����þ�=�y�-()"v���v*��!.?�!�?�*���!�_s�k�%���he%j"(��u��$���7� )9���l%�di�$szw��9߹|����t��|�;g h�2x��~88���2�lw�̯�ps��uq����n�����n �ӓ�}gɣo��^7�o�6b�=9|�����1����es\^f�w��7��p �/łǔ��<.u�jظ*��>qs�r�t�o�w5��޻�⚺xgu��j����jv�|�aq}ӿ����ww��ˁ8����u�|�>�z��:���<��7 �\>p\^�� 7�}y������q��~x�1�ƣuu|8d����p�� fy�g��� ��n�=��̛���gܻ�1�� ���j�z�ѻ���u��8������ �� ������p��o�8�y0�`��7ot�`x`0���r(��[ ��(߶^��w^ �b��aq#o�����ԃ?��������z�������@�<�_�_�_�_/m�����jpe5�r���t ���t}1����?�qc���!�t�x���qɨ�{��{�����l,�x;�\>&w)�q�g�뚴�_���v����?<(n� �s6���������{�  g�`k�/r�k�g��^��g�:p�����a)�n�s��,�d�ы�c��b����:�zڱ��e�a۾�0111111111�.9g��(��e�-2�ʭe����_�� �q�?a� ������[?�af�[����;��/� �̗�x��w��� x0�v9�c!|2�b�l�� �s!|�. >��up�{ �����|/�������ih����|{c� �� >���p#���7^�#�3㮌;w r�e8�n��>��o�^���c�崏" ����x��y8$}�wx�@�� �q��}:j� ��့�����n����7�/�'|j�_��19(��;ꐅc��!�/`ej'\�о���=��ÿ� ��g<<�@?!t&��ܫ�}hׇ�2��w�!ŀ���:�;���fd#���>��� p�~z� �ǻ=�{r���=��b��87����՝� |>k���*��(� �� �amxlߖ{��<��"�`x����l��!�=���џ�3��р�2�'���n�3hw߯� za�7�v� ������m!|pg�{�op�;s�?�!>��'jxrk���i܆2w�2�ܮ�{�}��n�ۊs���0��ړ��3nu��g�%<�(�2�ћr$93��k:����"v2������e09�n�@�i�fz�܏�)�n�w����d�02-~b�f�j�z�"�b�<�/��)�=3�\����y ��d3����ivw��߃p3�;p&�;���s� i�d/w��{�u�c w1 ��s�|ç(�����x��y�� �@> ����'qe�֒��,�6x[���g�q����g�����7 _��o��-����?�mq���c෾m �n���y����}��� �����9��c��mllllllllv���oǔ�. ��v� �v����?'�6џ�}��0� �q�g ���e�%� ��#d�=��ң('i���o��kh�z��^��d� lj�"�j��h'��hg���-����i�p �ϐ�c�f킾}˷��v���ӄ?"|��=�x�y#zl��m'�~)y��y�n���?���$㸀�����ܓk:(�֏:�x���$r<�hn�ӟ� � ��1t�a|�kh_d9�;����j��k ����0�����e���u� <.�~n��d_f= t"�m�ϑ1rmx�/p��87�iբ�2^ێǵ�״ww���:�� }�gh/�ʗ��;ϸ��⋈�=�2[u��(%?�d�$k�s|��t����j���-��?y� ge��#��*�'i�������ubz�c�v��n'�%�:�s��>f�t�l܀�c�k=�z��� ���' �lbp���}(9����txai���mm���� �g����ڤ�bg�uy�e�!�k�q�_���{���h�� ܽx����abp�ig1� �u5y6�h�gup��s]���_����=�\�d���tp����h�,w��h2�z�enpl��yg5�>i���g �n��d?v�(d��4� ?�n^se�}���оu�xf�lي��*��#�� �m���˴%wxd�wv�5`���1���e�9?��<�u]e6tu<���g�{�i����zlzk���av8�& ��k,���*vo��?&�0vs��x�py���l��'�� �\�v�i��q_��w���9�m��\z�]�=��x��)��teא z��zk]�8���h�� j�����������g����o711111111y nih;:fd��wn=x:��k"���p_�_x��(�%��l���$,��r�;f��a�s��[email protected]}��un����x�!_`d!>}�| ctfr�i�~�w�r9^{�h���vlt�_(�8��r�wӆ��v6�o'��.e��e�=t� �/bq3u�'�;k�sg ���*/��4��{�q���b�����v�n5_ğ5�����4�0��gt��z�'f��u| ��c�d8�dh�k��ti,m�v��跈=? �|@���x @�b&��5�fys|��]�}�f�x���i�~2i}v�0b���>$��zݪ}:2�|a��=p{�/� ��gdï��؀sꎶ��y��o/ih�r���w5����6�w���u���o� lx�탐���c*g԰��ƞ� �5�u ���%��c&���^��ޱ���f���j�ɐ��܍��g��aֻ̿�y���93��=5���inu�v���i��^�/�2e��8vgs����hr} �m���,mjy�%�ē�@�� $�]��vu�ӂ!{��/�:�x�� [�w�a���[z���d����ī�_�r�8ћ� �x��t�,�}��(���f6�8y��������?�/6䆲��%\o p(�2o��n�։njˡ��"ȴ�oic���6�k�ox()[email protected];�t�a��:���'��=��&�n��qz*�:�]۳{ xr�57�m^<�w�o/�^g���չ&&&&&&&&&&�l�^馬�|x%z�dze#a1y,oj�ow��[�r�ʈ�[�dļ��oa�9yѓ�٤z��ҟ_=��t���cbn��š)��&i8���m~� z� ��� uzә�@�нξ�#��hw/\�`�3�l���<.s����c�2��d������!�}l)�5 � ��[email protected]�u� �z���!r{� d��ɷ��l/�w�`u����f���"@z��|��ƀ\ֹ�q��[y�&ǥa=��=d�x���{��x������m���uf-e=���j�`�%��l�hu�*��ټ~�ca/� 7��zl{ �;x�i��0�$�� t�@,ra�-m�!n ��_�-7e �%cnԁ���hr��{f�:�i ]� ���jd�$���wx��&��~�rap�dyh��m�,���ə � s�廊�u��0�j�)f�s�q�f�*,��kp�s�աt��un��7;!���8�b�u����f/�]lz驮�\zn넆ʒ���������l)��%�퉐�f�30�lt��o�r�;��i�ρ̷� ��|:�dfj%h ��8��;��igg�j��d����q|����<>��d� z�����!8!d�cv�>�1�=r�1���(���\�lea��v��e�s�t��p�&������ntb��0ga�jo�hyv�5 z�m%�ᤄ0�[�v]��~��x",�jn�uz]2���0���gz��� ʉ �۶�1�����o���e�]� 1� ��'�xyq2:���l�� �ixh5�"�u)���-ңgm z��p�s����n�����[�8���:��tfg�ݕ�s�8 %&d璔��b�j.�氺j���ܩ�i)�0w��te�z�m��t }�p�� uä)(�t2�$��0m�eo��)gc�a@�a񼱠���gp��l}!ĸ�5 �iè��b��0e�1���yins(�r91z��z9�q���0�b�ֱ�2b����?�����{�x�h��v����4t���fs�o�.�9��g^��u.pb� a(���!� ���tfe|e_ 9�3�*�z�ce���%��j[email protected](�75���5��ӂ x�4v�g�dj�� `�8���@#f�/m��_��ט� �ou��vms��!�l;�vd �m)liwi�7�uy�p�"� ���ma\��} t&��bd�����j�q�%ہ�h��@)�f/�4詂jl��r�o�ȅ��� �zhj|�ʴť��η�ķ�@��t�)��򺡑2!�'v�uy�������p�yik��m �(f�f�w�������*��l��)��-����23��zf�c��ho�$�x�u��2��spc�uɏ�s|�n�m�a�ɮ�mxb,��@m3 �tɢ���1q0�˯���:����%ep )֚�>�t����� �[email protected]�;'o�����3cp���…�������i�!�s��l�n�lbr;��\ʷ�d����r�%��^ö�ίzk#�n��y����l:����c6��@��ɗ€|���c*w��v�9�� �mg:j��ood�.|{��f���d��:b[&�r�1�wa5jr]��s�lܡ{he弑ϐ ؘ�~n%�&�y]m��|j!�$; ��Ԥz�� i�s���"ҽ��&���y� �>� �:��o���~s�t��#�k����.�q� fws��0p�� �^�: ���o��*}f�[ϟ�w�t����i�òri!�a�hs?b~fa�'j����0�}zbu2bh�k^l��0�*�f,*@���x�#��2����\�hcҋ6�������a������as��s΅oou]����stfw2��o0��b��nbbbbbbbbr�2ͷ{jy ݳh �t����-p貑��!n �˜�n0l;�b�8��b�[�̫g�v<0�a�$ҧ� ��g%i��l��n�[ywn-�3� / �b��%a�p�h(s�a�m�.6l �l��:}�����$&*zdпr~��w8u7��c����(ɔ6ivӂ��fͱ�124z��y�f����7q��&��ݰ�t 4��1����uev_rnֺ��.�����t�����k�0'�l ���� @e�1ixz'ب�&������̛ us?��rm[w�t))� ������������d{�����w�o�w���^>�󊞲��e�5q�ޜb�\���/>�3�^��zr_�ʒ�~f�d�v�o��aa�ʒ�o7�~���o7�:�sݭ��&&&&&&&&&��d�0�*��q�@�����y��j�f8��ǂ^�v?�z  � ԭ�(\$0c�:�ߥ�x)k'���br��$_i����xs儴dzf��� i��칼���> b$��ps�)e r�k5!��0\�� �@���fw䭽h)r�qgkȳ:!��e��t��#�'t���"@ �֐�'��|@�]�w�-k�2n�u љ�ب��*ehn�e6h�y-ea��!�)z�=z�0 e�ԕv7�̩ޡ��@�l�m����g8q�[!;�r��*ubެb�? ��`4f��yu�c��3m�]c˿�v�a�n�q]���-2��]�]<�58'����]���1�&a�q�����șdc�<}vz>������������<�÷7���������d��1���i���������� 9�io�1 �*�|݀��~�i�c!,3��=9�h��f�}*c�iqw�c`ڨ]��|{ͨɕu"��j�����ilg�o�'�����1qɚ곕b���.�ѥkli�o��)0:���a��j�j�s�o�g��#�ηo� 6��f� ������s���pt���m��g�l��ۤ6-%)����u#^1����ڜ�o�.k;|{�*8�o���e�et�j�fmh���j�r�o�|;i�&/�bmc�o��o7111111119�����;e�n!�ʍml�q�_!��[��5}�ce5�o�}�h�h4÷78�h���q��v�;c4����ow������[e5�s �jt� 4���|�p�v(w��$��䷻���?x؊o��9m���arp�p����`|��ķ�����y�����j�r^|z!����·s��5�]r�u�=�]�ԁʒ�f�y,稪�l��b���t�-e�|��g]��]��=���&&&&&&&&&�-0��z��ja�=x�ĵ o��t����j�d�4���r�m -�nb���*[c�riq�̷tzq�`����z�t�7���[email protected]�xt\��(۰b��g���z���<ח�md镪��@�>���p�8���ą���؉:�����5ŀ{�|�k�vߊ-���äo~�4�#y���d��1����/��n��#��:d�$�5e����hf��u��9�� ��p !e��zc�a �8?&rlgw���j��t 1eh4�dl��t�z����#!��a��*����$z#s��.d=_�� ����dc (���0%�_���&��|��t',�0�%2�b��aqz�6|bʷך��)�rb7�k;9�0u��nbbbbbbbbr���vja�m&��b�3"߮lm$�k��b(xkq/m�7ml�]]���цf*s�;\ hv���ț��]%ǘ7�e��d��lc(z�? 1�lw�]w޼ǯ�f i�#��k�g�'�by%��g�!���#���a�c��srr���@a4,�� � n��b8�i��i�� ,�]�ʋ��2��ki�t:��>7�y�r���<$>�ڀ�l� ���%r��z��*�k��(r�(5��uut�{��]eee���hz�����̕��t!�)�-a�u(o�=���j�~l��ĕ�ċ>b��cscêqi=q-�b�%��2w>mt�(ջ�!je��q��h�b�42'��s"�m�%#�ɓ, �;:��m�ϕ��*�|hbbbbbbbbr�2˷ga�����p�mn���d�x��b 9 -5�d��u)��?#��r�,�u�hc����j��� �x?�f��.�w��g*�6 ��1�&�&��g���(����cp�)�� 徉ow>>`b�[�=slhy�2c�ce���ն��!b&�t�0yg=�41�~�—�4fq�s���擎�u��@�f`ˌݢ�}�nv�o���ʑ t6�zxk t��������`�knnipmd�t�ɮ֮(a�d9�e�4�a>wԪa袮�ȴ�y�m�z�h\#�)�����������j˷iz�x�~x�b�u?x�룢1.zm�e��\��ia��o*n�b�.z��� 9 ��`�~�a��z͠�p��y���� d�7�ب�e������^]l���`�t �&4�lp�1 3b2����� ����������~o�� `c�{��wk��}����h��a�`��jٖ�ś�v��=�߀��v/�c�g��oo@n�1hr��" ~�����wa�rsl4e��#� \�)��ް*5[аm�fͱ�@ֺ��s�,֫�a�e� z��[ǎӹ�k��w��yժ (aܰv���mt��8�ه󭊞u�y�u�yv���z��w�px��}���d������c�·�8c�4�z!�w l{�c�~̋ؓ�;����\�� �x��g��݀w�� ��u����#a�fͱ���ezy�;^��_�!���� ��g���k� /}� ���y��l��7�}��/=~�8�p�ˏ����/['�&e������=w�o�k�augsyo[]�,�����6˟q��z<�b���m�����t$\n���|y����go��/=�kro��i��ڸ��v�3����,yii l��=j��g��/,���5�"��n��# ��r8r>�>rjy��g�\����*-��r�n^�q�py�t���������������u�%�c���������~�w��� ����aq��=_�ϟ�¾zq1a��\�������?� �8,�9,���vba��/2`~1d,� �˛����|d�g���y��/�����/.:q�yط�z�;�=�7ƙo��f{�b݄5h5�qhx����__��?������^���n ��b�8_�[������j�r��׆�b,οx���������#��:�,���t�/y���u�˫1����_��o��x��ۃ���fy(/�k�����m��8/:/n|ѳ���_�w�k�/��{�b�����z�h�8�}�a߂��a{�x�x�������x\p�g��}�� ߞ�������""�� 6��g�?wӎ�;��¥�z���{���u��2r<���>�|v��g=6:�nbbbbbbbb� �vٯ�����^y�{/��ܜ���b��� ��fssc���� a�%ö�g��%.����z��������n3��oe�����?���ƽ?����j���e��wg�v����sskoxx������_ |;�x%��������)��&��%'^���\���nk��hon����ɹ�����:���iv�@��x �z����_��=����w�ߋ��d#� �>�w���~�k����h]�ۆ���պ8/;uj]5�� tf�r�կx7~�����)��^婪ȍ ����o�����7����� s{��6�u�3�b^u����ss��͝������,:|{m|������������z"�y�����뺯��?�-m���a�`��a�%�׵�{.��\r�n��d���s{p�|cس�\ r��ž9�a{ ̀�kxw�����v�����h�sxq�k�ܞ��7����9�7^���t ��۝p�8"t�w������o��?�ݜ<���k��%�z����~� �e���gϯ��<������ {���e�#|{��ǿy��q]���j�=3=�{:m�����}��:���� �sx߮m��b?�gl������3��� x�!�i ("!�0 ��f�&t�x��s���<����vuuu�sϲ�wέc=lt��3�ׯv�n�4�� ��(�edz!s �qpe�5jl�=b8���x�b= ����x! �Štfa,��%uxk��4";1y��{�m|v v&~y�t�<���|��� 7�c�zn9c��:"��c$b�x�&[f�� �%`�c&t�*-�f���|ї�����cdv|��*de�:���2���w<}�g6���q� ��lp�6h�"�b<\��r��hh�j`8)q�l-3���,!�w4��tn���"ê�-�s>�d�e���l �uϯ�#�v�������'�#ģx�m����$�g������cr���v~��s����k$�s¢����fqǔ�lб�v�8l1��� 8̳|nʎv�5}��u�����5:\��-�,jmj�tв�� 2yh'���y�=�x�r��jjqš�k��v�]s�p�2�q(��f���nl���?���-��,e���g�z蹫��t�tzv��c[=gԦt��r8b�q�d��=�3l1�����ph �ɔ�?���a��¸��������yz5��xu굕����g6 �i�rhb���am�n��r| �le,!l��x��%�f��*��ƈ�t���� iq���4"�ueå��^>-��y��.�� k�a�c��%�xb�%�xb�%��x[z{�t����^�/&%"��&^p��e� �$�$�ͽ�a�b�ui5�=k�vë�,���ak�d��.l��0vzej��ż�2orl������d�=jz���.�z�����\��hq�ukގ�p����he_q��v �=hk�*!o�(��8���s��bi�o�x��3���8g��bqr,���:o���ɂ�ݒ������(�s��ϛ�$]7����ܯ��㯯�e�g>���s�rhx~ӽ���ڹ�&�em�hj'3ꢼ�g�r�c�3�_x��;zy{�ؽ���k,��k,��r�v�� ^���놆_e�[5q�4�6fk*�҆ ��h�n\@:�ƺ�*�*�.�b�b�e�9��d5i�º��c�~��d�|�d�e�´e�0�������e�z����a��9ɜ�shޅ� r{ە����®�]�~ w~b�q�㐷;�g��i����b�:";)��� ��y�[=)l�s�"�e��*\x�ճ�qrk,��k,��˒��򾗿u�l�0 a�l="ba�m�pm�о�7�x�^e�krre���|;� �"��)u�q�f�o&�6�̚�ti&�j4p�n����j�%�yǡ���a�(���~�m��q���⮯]��`�u�bpk��r(��=�����ghk�k������z�g�ʞ:� �)�tj��,dyg���l�td�/�7}/j� lӂ�<��>�����uş�k��i�����ۑگ ��h�c=�� �j�oo���0���|��[~�oo��y� x�� ���ұ�{���ѭ��)�c�u�҄��v%b��6|�}p ��*�����v0�kj�7��y�7m߫e�i�79/o7'����6���mw�i��x��\6�s�ʊ�) �p} ���i�ǣv�� k͎4���]gx��>���;n��'�r��%��d_[�nj� b�%�xb�%�xb�e %��[����#h�����-�1o����uj* ���d�)�h1q�d�u�q�j]�v8��]s�ja>'╙����.y��¼�o���{������o�ar�;��������oiu=���]ٴ��������q�ɵ�۽7����3-v�2 �c��{s���{�����\��ǵu}�ԑ�&o}��m���o_p��n9.��/���z�?���`b�$�!x�q�#�o,���$g�j�m�1 ���x�����v�[7��� )��j��v���[���m�1�r>jyh�\��&w��%��.��4�%��n��x'���e�w(t���w�&k,�d��\����=�xb�%�xb�%����}�\y��l� bf7[=�-�*t�e�2�kl3�ncջx;� "c/̬ϯ�)��6rb���a1v��l?� _�՗��x�"l� n�9�����]ix �u����đ�\��o�o����eg�h�"�_ ~hn� ��v ek�=��[޻��2dnns�f5�$4�%@��f3�(ȥ�]�{d*�oc|���׿�''���n��g-�~���˹�7�o����7��& in �x����ށ�ck=�zf|)5��t�3i�|#l5� 7t�|��[�n�3o1�ּ� 3�k^atfլ��m�m���-c��,��ď02v����ӆ�<�кt��/��c��w9��x��$a��e5;������������k�9���[ s�7>��ӯ_����s�|��5��l=mx� �t�(nj����e�`���bm� �ui��>׼[����md8�#8��щ�f!��㹤q/�z���s�~q��[�ܹ��}̇��jxsd�sz�����,�9,��ůd�b��mf�7��7_�ֱ��.ԇ�gjc9r|��h{����7�̧o��l���[�_� ��neަw�m��x�6p�� �9z*�ƕ{-�|�5'n����=�s��`(˱�ri���pd �%��iu�i�-�z��>�9cyo3p�"�9y ;o��[v���,��e�8n��ന��� 2�3������3y�)�|�o~e~<]̰�e�y���<�� ~��=�y���oչ%«x�q��m�[a � �8�k,��k,���҉���w��rkv�hp`il[x;2 ��� �p�f�:1,��d.o'�{�w��;b����.�m��8�� rb�sr�57��2��� s<#��|�h��$h�b#����53���af>ob=b�7z���%�����d8\ ���`��nj˃�߅3˺�g�ɼlo�å�v mq���gei��і�u�q���t�����q�����ݟ��ᘈ���➯���dѓ'y{����݄�c.xz���q4�p�$`kg�� �<�h�:�ox5��<� �$͉4l�3�0 w� f�� ҥ���&i�ᒐlx zix�!�����g>� s�?i��=ގ&z:�����5���/s>�4y�������vov�;@�-� o��-��]hn��}>9���7lc��۱m�t�1��xu�ba�[email protected]�?��3�4q �e�sxh�l�y�����<��e]d0m�:au��x�˔�$~���[��8f\: ��^�=��m�k>� �-��b�a���"�~1("3�g�]���&>#ow,���l�?��m7񩀷;!o�����޺��v��]<[�ф4x�<( 0ӥ�_���/�'[email protected] x�9�bed�6��4z�� ��vą�o�� n��к��.ԛ%�%�9�>�^�i¥k�ŕ�� �z�\�ȇ##e <��j�rdn�a|"�[email protected]�6�(��y���մ���e��o���@����c�^��}ưj��� �r} u�� ��e��6&�x�b^����'z�xc�0 ��e�t r�-����]�r�/�<-�0pύ�ae#x�c������`��#�6��-ʣ�-�� # ���=��b�ƭ��$tz�,���ҷ]k1��!��;y������^}���7!�z���! ˒q4���k,��k,�,��}s6#y;n��x�v�ls5b�d��]yy{c-�h�dr#t$nuu�յ��:k$gm�5u=�њ��3ձi:���5ej1z�ts�j�j���8�q0�st�p�p��u]~���:e&d�m�[�z �u�r����n� �.~�����t�6c� .�zo-�tľkj�1rն;� �*�ɨ�´���?�:m� �]��:٬b˚r�뉊�,�#�&c�h<�z�����e�^�~�3�m���p���y��g3e؆4*���6 ����ʌz1�q���ť �.��*v �h i��|i�ׄщ�>��͊��rhՠ��r�?נ% �qө�w��/f����>��j�����g�b�� ���auu܎�c!�1�qv� 7������d]��wa,^h8k;q��v��^�|���x��o���|^�^u�:t{������1knv��;���`�ţ���(�$ԙ�6��&m�ªg��t�f�n�1��a��ٜ�m���\�jl�����&�f�*��8<��j��u�tr��0�̪i��.���q�)q[c%zl�e�؅�v�zsa9to\�@i����i�l(5]j* �y�lj��v���lu�өtyo�c�)ͽp���tt �? s�y�t&�b�=;�v��e�������~������, o� �r�,ˌ!]rz� �����tr� e&�������9 �����#ܗffur�r�����m [m�y��� fk�a8h3v ��0�3/���\�t e�\o�.�6��n��*����d�b01�f�x1 �e���� ~<<\�\��֪ ��v�n�s�pjszs�fo���=��rq=sf�x���$4��gz o���o7���~ů������l��.����o�d�!�} ab"nb�e���a�l�ixӓe����0�q1^í5��!� |2p�^k���h� �o �l �5f�"�i2!w��p� �l�s  `ik��3�&���-a�.������m�'�5�č$�si1y5]^�"� v��:�t�lp�� �务mkh�@ w�e]����sܾ�[t,�o�ͫ�|�������-f�/��c�k,��k,���yk�ޗ��r}�xh�~�:��0�m�r7��n�e��fڳ����b�r�lhqkrmh�d��ج��f;�]� fvg�w�?:������ե�ʏ?�^�/�-��-��-._s�00r05t�="gyw��٘�w ��aje5n꩗{{��s�s�=��ӛƛmx��� otזz�(e������=�']8�ꩨz�0'�,�"�y�i5�7�ޜ)�?6v���uã{�=s"����'��c���]w q�&̓l�a�ۓ!��l����ٓ�ב�p�y�,�kh<�ctjq6��,�[wސ��w�ۙ�� _d:r㶍',�y,ѿ =��7��p����5��)��u7��g��ȕ��>�>��t�q��g^@~��<��zߟ>& �/7�w"�e�o1���k�rrr���3���ؚl�rq�h����{vd�^^�ky����ٻfr�?9<�9����p*5�h���i��2ѓ|���ف����:o��.��������/�,��.e_��>��>bb��о,v=4<��xz<7����c������f ��!��������6��z� ݷ��`)�*w|8_zb(����"��~��4}szm!��tz�xz],�*���gw�um���fhmx5\��&v�t֓{�6�e����>�y�e`tog�i��w`; [rf�@�u��f��cf� �6�s۾|��m�~\y�� �]w}/����wp��^�{�����]�;ܷ�dop?:=i]q���&l�"�3$m�z��ϊ��!����b�ήd����ցܣ���e�|�������?��o�x�h����]ㅇf��2��=���)5� e8c� ��������ۻ3d�����䇟�n�|�7�z��r�� ���`[email protected]�j�l_:�}����q�~�%k�z��dnю f�ttn!s�h�)��y�(�σ���z���~��gz�tq�%��_�us�ml��\yʬ)�7�k�gf�w�&��2u�ҫk;��9�����s�=od����ݵ�k �/���b��/ ��)gi1�拏f�ʎ�� ?�/n��t?�<����r�ii�%yu��tz$��kl�4�d�gd�q��&»���~�w7��s0o��{־���j]���/�"�-d�yrr�˰c�e��\����ڛ}2;�&�pa8��u� v�|����)~螼x]�j8��h��éw����\깉�������� �ę�*̤ s����՟z|��:�<г��f��� �alj��ur��w�"x���,}� �s`tsa�@�/c)��ȋefj�|��:���u`��\��(-:�=��8e�9�'�{�%l�ȇ|�zq\f845��|��s��f���zw���lz?�y]����>�ds�rw瓹��#������}:zoj�t�rء�sk�gs�ө������?��~t�_x�ym\�m �w�2:�fi�k�������4�0��'�]|?xh��k��(},���;�� ?�ql8�y�u�.\��5���fbziԩ�ԍ\� ol1ն~��w���s�o����x�5�e��k����=�w駓�� oń���e��>�vn��{��{l���p��\������������db �)e�a����<��p)�z|챑�[[�к�߯.|���e- �?��7��@a�����ln_w�1#ubs**s�6�(g4㐚8dt���z=m�v���"�s��?ٵ�;�qh���������u�si����_�jd��|f{&�r����]wu[�0q��zꨫ� ���l=�����#��.*�� �h��z��… � v�z�%��g��ig�}p��b���˴s�v�e�? ���ƹ�m�}c���vz�)�\��w�t�ep 2ђ�p��f��7�xb�%�xb�%�x�p������h�;��}h="ubg(-cjb�����v'��:��]�p}~�ƒ�b�c? ��qv�'��χ�7��nȏ]�_~cn����sc�����2���$o�-��c�q�)��7�vߟ�g(�do�q] ���������a�w���}���o�)>�5�)]8�5x1rs]�w���n�-����}d�_�v��0�xg��ʪl=����>�sr�upi"-�!o�i�3���� �s������=�}�>ˈ���]�g(�;m�����8���?fw��w�fdj�v�w��z*�tofe_�߳��#?�y!������j��a��d��ư�b��z �u��'>�x;$\���(y����_��ݭ��b̒决����gm����>s��x����uc�?x6�����c����w��)�~\*�{a��cŧz��ow᪤q6�v����@ǖ��=��f�9�⺡�n(}��?�qi���¿����t�������)��\�k� 7d�~�yv���=�7�׮�ӻ1���� �<�6#;�;�c8w�h�_�c?��*ޚɾ���q�on�i�=���\��|��� �g��z�ө�ȡ�f��y{��'蔞x*�{o涞�����_���؎΁j os #���з�ᣴ�a�.o�jm���吷k��|�y{s�o�{kg���v��d�n�r��r���&��h�o���x�~o��w��o������ה �-�)�3z&}�@qmwaw*wr���������દ�mv��=����k����j7 e����g�� '5d ��o{�1��q�d�=�i��@��g�-�<�ߒ(w �j��8$\t�s��ɞؐ� �j�i�_��g�v�uo��d6jy(!y{s[ '̥������g����4w�c��z`xg:{8�q��ڑ%����d=n��%�u��o2".�_5��w��3�t%p;�&,�#\\�����2�{h�w��2ÿ����= �]n �h(�y�2͒�j��eu�ux�!�� xk�}�r�v(�rl�`.�]���үj�ign��"3t]n����������ɯ�nn�5�e?*~>����ķn�z����uͨee�u���w���mv����c}��3�c��ݝ�iu���uejc3�j��j�܊�gz���9�����7ws��/�z[�y�m5rе�h��;:�uw������� �}�0~svp{:9i�im����ut�q:,�x��g�zdw�x?$o���p�����{z��p,��?���"u^�x0.�##;�~�-��4���m�������p�� b��β���o;���w�ɿt$=��j��˺n����9e�8k����ew�l�׫���.���6�>�u$o��9��pdo��bh��.�u�3r�s���¼=�<�“�e�� �z��������{:zn���[n��e��}/������su��;��1h4ĥӝ���cz�$ �ҥ��m��[email protected]� ae��8���qq�**�("����2�7�w�w�_�f�n� i���k�����ԩ������{r�ޗ������3u�呷)��]ީ�c0��[q�t���:1�.=�w�${���}mk� �x���u���u7hw�v�hw�̨�&�j��_������׾�z�zy�}/��%��x���0����^}n��cmm��ҫ�`�1���[�1j�vk��t� �ě~�(�g��ijsqw��v�8����[��m�����/��l�/��{�s��������o�[�g6$_ �ez�k� �(���1u���y�6 �����kl��ƕ����k|��kzeoeیpk{l�.knv'�u���.v���وe�ι���6nu�[d���v��~� 3�/uuv���!�^�r�5��&5�imjr��Ԥ&��|�o�m$~���� (�o��ř��<�v�s�g3��,isi���ۧs�z�7�f9g�x��j�5x�p��j!r����o.���h�b�6$6��prql��1㋆�b0��qm� ���f4��h�o�ds$v1�"t�yv���ři�ػ�)s���8�j>��l�'���~ڸ�����w�數d��s�,|����=|iǖ��t;��ퟛr��j��1b�b��n���������i�1>x�'j�z���j�x��!b �r&� i=�λ�hð��.e�s�%����v1>�x5é�nj�&t�ń3ek�l��`��o�|�ľ��z�\����qt��}�e�b���,@��x���٥1gt.k�n;y�h��_&?f�}��1��g��t�9��v���_�8�z�vùg����v� �-u���j�ӊo#8wh��_��#b^oءuv,�a��wu��6�~�z��b��>��t�q�o!���j��w������t;���.��ў�՛ٿ �n���ַ��[o��^�ɯx�֨s洶~�o�oio\��yޣ�����qwk�xe �l"w.�������! ��qz��c�9v�c��#:^�(�io[email protected]���n;mr z;au�5v\,���*p#��q�$�'�� z ����o�n�wy������x���j4�i����k?"��v *�f��ƽo�e��j�x����b���瓼a� �l�q�%���^��]��&>o�wb�0��б���e��*��x�8�� �i��x��e�����cyn��q���uj't���yd�"��8p�p��0݂d�et�8��� ��� ?ͷ� �}'�1�?ŷ�[email protected]���ʖ�:7n��ʿ�{�rwc�|�l�v��!���&dy������~ֆx��1?i�\u�#ϲ �ӧ�5 �g�ucg<�x�]i�x���d�b>�h�l���;w����b9î9� �d�$t��f;�kȋ��^�;ؼ�<��#� v�`q6�b� q�wq0�q���n5���vh��u۔nc�0j��c���v�g��j}(e'f����mp�x�,c��!�c�x h�j��d�u)�d���d�z;;u���;�rc;g�� t��p�aհ���g ߌ��}j�.�u���6�:m��m�;av�����^�$�$�e��la5v���y�v����o��@� [����ʒפ&5�imjr�����o���q�=� �od�m��zu������e�x�?,��n�-��b�¨ӕ:a �p�ӌ\���l��r�s��p=��y��8;�0�q{��յ*jw���8�~�0�c�&��2q}cl�p�8�kxc�/ �9b3o��� �.b��gk��ؐ�vza��j��cx�h�1���o�n��ax�i���w�q��e0q� :����tg"�o��������(3?�i�ln"%�\o��|`�m��:�8�@���*/���tal��6 ���s�ͤ�"`2���z] �[����t�q �j� grher%�6g��ϸ �s�q(���h���~6���?���аz����wg��5� |)����p���� |5�� ��8� ����1/����˯ք�lu�9�;i�1�8����:��~q���tb|���{-� wi�#�w��&-k�#� 0�� -b܏8�՛<��cբg��e�ܮgn�s�m�k0�z"o��"ٺ�d��5 �.����&�q�ӱv׽!���wɩoiʇzݞo![�g�,w��t(�&�cn�)n�b���x���n�����춓x �to�����0cf�o�imjr��Ԥ&5��_y��|;�i��ԉt^�.c��|ķ�׳��qۃ�km�����θ ��;[�z�6*ːu�u�{o���-a��٨�nj���)�e�ʠ�i o|y�&�o�ώ���|)hf�lta��q�w��q]�f�ԍ��4�sl��2b{�����δ>o�d�%6g�� �w���*��� �8�w ��g����tg�����c�:��\oct�� po���r����hc��0��s�j;�9-ɧs펱;x ��m�����%f)g����f���;�͏��ex���gw����}���~o�[��u�5��&<�gz�f��ۿ�oc���ھ~����0/\���x������~�gf<ʁ�?�qia� p��v�p�=p���k��3�i��#�r�泹b��s�q�r�(#]=�1c�f��&�!�����6m�ǽf�i��m��t1t3z��2q ��f�s�s�y ܜh��������`�;�ne�;�:�u z����������������ɤg��&|�a���nմcp�;a��o��oz�^y��eo�����i]����ew��z �4 ]��x�[�g���:g]$�y���)<bυ"�acz��[rj|;�aa b�"l�ժ�"u'@tbud��˕���&�jy�{�����w ��z�e���4��s�che����n:��� ^f4�zc�'���̓.�a�z¡�b8�h��d�7���nmz���08�� �|n�k���nv�1.�����a�����sq�n�~c2j��v?\�fϋ���qb~j�w��igd��mջ�j��`��.e��фs�������"���~n�kl��c�d�%�2`�fx������hq]����� 5��m�f����o���>�9�4��k�sx� �����u�ږ��z�2�"\�<� �jnz�p�!�n�j������.���j��o�q�dv[��n����b� �p�`�ma�8��/]��i��$�n$��ӽ<��*]�x��􋢯�k%�h'����*��m�����{�/�d��g=ۨ�e�w�_��!��^�v7���y*٣��n���hwˌ�zo�#�#=5��<�q�3��ο� �n�mnzi��uq�ϕ�wg��b/n��xmhzr�l��t|�y�k��u�r=w��3�ĵ���i�8�i=b�5�ӕ��]�ך���v�,t��]=s� ���8;��ghl���p������;ڈ�d���թ�� 5b� �\��������yd��*[email protected]�xcի]7vȕ�j����o��{�郎s��v��ɣ} sa��6���ߢ�ea�t��g:ю�#�|� ����n��h� u���3� jǝ@�ʙ��t�^���d^k�c�.��:��^��k��q�{t��l��9�6�"��d̅ջ�k��r�¬�8��u�;�ոō��<�ɍhn�?��b~�f���v�t\]b^t�:i���p��̱99� �yx_�k��b���߻q}ktq�gu\�fԛ�����^\β� >�rk���~��t�i�m?ng?b:�6��8�t:=�w{�[#�����p�t���x$�@u��]zv��}��&_�ϙ�j��7 u�~�>�!sg]r�v��:x�6\q����l�>��t������`��ry�j�a�:��g��\�"�?b��䫻��(��^��Ԥ&5�imjr�/�|�o�����q��)�`�ĸ-g'�q2vզ0x�1yoҟ�|>��w6$�7'w��s{;mq�)��-��_c9a2�\�x��e�_�ctk�9 z�ki97 ���?�&\d3)2��ˢjf�w�4gk�!�m%�=nv�t��k��j� �d��op�t� s�����x�������y_޷ ��>�����閖���v�/�z�':m�h�"��vj�ӑm<�h �y�'ap��m�{�)�as6�,�2� ��:/���e�n�̫ˌi�?8 = ҁqqe�) z�:���vqخ��lr��v�wem������d���<ȕy��4��]�=yj�������=b������vg���/c�� \�u�z� �\����:���_����"��?��o���h��i ���wg�|�����g�5��j�}�=�o���k3z�=���j� }�ךƿ&8�� ����trw*���p�mnn8��j% �{��pָzj&}x�ԅ����ʌz��_u�oz d�8ir�|��ג��a�� =ܙ��$�t!��"�%��l�����wlg��s��ϧݳs�p ����f� �s�o%r�8��d \��]we����~]�����eǩ��ɷg�k� ��_[ߎ�"�j�e���9��q�(��'�� ]aնj������õ� �*�)�[email protected]��ْv�hֿkt�{|�������j�0~�<�,߼�t��^egu��>�7���5f�ĉ'6�����!jj�e�� a�h#� !j3[email protected]$!!2�2t�t��[w~�� j��z��>���y�����}g�}��{�c�[��m��6�3�s�n�p��$s �����$�s�m�_zv�6a��c�$v��^�s��>& 0���y�����9�&x�uw �amge��i����d?�tyk�7��r��e���&��2��d�f�utw�/1����^�k��6��sl�--�i� �e��5�owˤ�(���%�< g���h%flc��hz�� ���:q �q5���?ą����k����_�o7y��y�pf 3k��cd]&���i/�� n�&�of�‘&��%߶1�re�*s��ԫ����ŷ��흧��5�5l?�g�{�������zs2��큮��� �{�{���r�ղgq]pqһ0�dj�j��������wf�í�q��k�ki���&�m�.�nn[���nw�yֹ˃>sn��)���f�n��i��������� ݪ���ܤlnw�nbzü�pea#j ���t� � �b<��0�����ǵ,i˕\{��2*�$*�he�����f�ߒ�8���ju��9zx��xlu=���ݾ�َ�t}��>@m��imkzӛִ�5�i}�����,_7ht�s��� �}�ޮ���e[|﹖�]i�r³/ttw>�zk��� ��2�|�b�}x; f�g��ø��ʉ��瓙��w�{zy���q�dr�����g����eby��bc$�x'� b����"���[email protected]�j���nw�-���c���3��3���s�'v/��>�h?|׽��m��84��$ �n� sk��"�<�e�����/r0b��p��^�\��.f8a ��(��� � ~���b��p�yi� q5����� ;�ߊ�ho�&ybf���~�mc(*�d��ͬs��g���.�a�o� �qt�*$k�"�s�}@�|r�����}�.�]�ł�'���7x�݄/ (i�s��e������x�9�ٓ��`�9 �h�����y��h��w'r�r��lregn��� ƌ8��z� ݙ���l_��'k��g(��t�smc��un��e���*���>�{��� ���jܒ�'��;����d�8�|�%�z&^�pߐ�a�����r?��e�d���z���8t�[email protected]��:o�乩��c��e��μc��� �9��.|�ԉ����&7�� &�mb����ףd�����k��u�c���?���їp�tf�l<��3�� �f��@�p�ivȧ�m$nphv�x�oc��~�y����|��#z��b��|��v�cl�pef�[ .��e���-�w�d���cg�=m� � p�'tbyز6j����� ڷ��� _\��n���=gu-�b� ��.��o9�j����*�����s��7��9����ҭ3�:�u�5��vj��_�8�!�:��-g�����f�[email protected]$�'[email protected]�!���^�r� �ҍ�4�w�|����h.m�g��� ���١{��'�� x#�[�m}=ٺ��<*���b��(��c�ꫫ��|�i�����誚粥�y�6���&䙹����� ���6>0صa4�-�6�)�|� ��c��~�-�g�ʧ��fp�7�2 �c� tg�(t�ս������?;���8��in�׈u��ȣ'��>��f2:�d��d��c��y�'w����v]�f���cbma�%�s�x)�ԓ>{�����9ق �`s� ܷ4���������c�w��y�#�<.�rv �dљ�v���{>�������m���zyv��a-���r�^ s����^zn��?m�ru�s� 6�ܮ 9ߏn��j��n����� ��)96��v�ْ�$���� u���w���^�v[���e��a����[email protected]�� ��*����g���os��� ��\d��t�ݖ����~�d��q�}��q��8�\f�-�^��1ab�pe4=t��f���[�def5���;>n�r/k6`�:;�a�s��{!���q���!ƍ�m��"ǜ�gs��c���s�.���:ܜ�pܮ3z:��� �lvl �a��l wk�u�cj�»)j�j*;a�p��q]d#�t�*���0<�m}a���wܗ������v��t��%�l�̔�ì� wm23���0��&/��t{���#v8hu��d�x�|�9sk���ⰵ��q�vk��mkzӛִ�5�im���g�oǿ�����d�� v�t5�ccv�@ h[�`a[���2�g�ج|�f>���n�*� �y�))��g�j���c ���m��;�c��s��'�apnu��r����� [`bg����ړ�}e�z6f ��!y]m �8>��p� ?�5�;�lqyq����n��?f�so:�f��ɺe�؏�b�%�z�x[�;�� �)6&��$*dwzx�f�1v5�)'hyy�����y��gj�耗]����h������sx38�sg���du��e����75�[�� ��^�;ȕ�_�,{s,��h,nesr����ʫ�@�� �v���h� ��g^����,fld�:f���?�p��o3�l�r�j>��q �*u�`��h��t� ���o[������\��p� �w�{r�;/�y��}�v�d�:wg��(�{�m��������_����%��n�d��ԙs�']=��a��a��|��2n�f�l��7��l�a})z�f�d���ox��fw2:��}%]&�z��ҭr�tt/�qv$���sb>�d�,pl�ٳ$`h€�"[email protected]^�i6��ɷ��w�����&�ȫ;q��茐wdn���yэ���nod��z�[cyih�k�oy#%������x��c�_��ta�/�ߩ�s���{u�[�y�䝂_�0�s2��7�[�� 6 \ �ib������ƛ�k���/[email protected]��ob s�� vp�֠ mbg�-�5�&!l�0u�;��ғ5����c�j:� ����. �_���wd���f����j���t%� �~����� �d gi�����za�^fea'�8�� �i���� ]��-p���o�[g�� ���� 1��5ϋ���{��$5�w�des��d��q����x��`�si,�/�џkse[�n���|k俜giq%�%@7������qz�� �w�q��uht �{9�q_�a�-�}������ѹ:[f�2�e{r��v��v��ļ���)>xrs��ձ?k\�˜��s���ƅ]6{i~��-����(l�ax��0(�]���>�0�������[akyḙ]gs��bl�qr�d<�ۥ0'�v� |��5h�<�]\������cv�ȇ�����l�v��b5b~]�u��kv��(���|�[email protected]��feaj�73����^��"�� #g�뱰�s��'��u�/��x?w&����|����ȡo�nwlqd�b��{��a��8�q����)m��p[��"lw�9_�n���q�]x�0=�s��lk]hy��x�s[ie�t#�]6����q����4&�l4 ��m��0� �2�v�sv��ƨcb���powf̷2�f�j��v�m�`�m�ڐ�(2 ���l�'^c�υ�( ѯx�䫵�z 3�0qҡm��1�5�y��|����oa����l��k��ld�w�oozӛִ�5�imk�g�>̷w?z��?c�"�c}��k^�*,��3�^c�d z3w'�i ��x��2���_kckh%�a�m7&�;���tf&�~p0ᑎ�"��t�q����f˷o"�g;g���{z��j�v�3�΅(�d�˔�[7a�ɪ�>�;tzq�����a�λ�g��uрq�.8��d��c��dž ՙ�[�i��db���� ��j ���j���"���t� ���z_��s� 9-n��hi����k{i��"�c~�#b}y�/sn�ƛi45p�5� ��>l���wj�t�&��㧻�da��a� ��,k�s�j��l�ķ��������� :�@��r�4����*rdta��"�]��i�,i�*b�]qr�'=6��wtq4.]���f5��|x�˒�y�?i.��ė�ba.q][����r���np���f��!a��fπ�=7 ���*9�oj$��9yr��£�n��}�k{6����w��e/� �}�o�̭2v g�lp�ՠ/�� �� ��[�h���� �:�:��ra]y�0]d�_�'����9%?elx��ykx����l7oi� ���� |r�v�&b��l�|;��#莐 a˷����>m�`7�?��:�_'��u��fo�/|��n�ʹ�c���l�?�?u��� �*�2ģ|��t��䭂� p;��e�zo���?,��`&����畚&�2n��tu��ex�`�v�a����_�v� ��m���}^��]�5 ufkhc�sm������b#��k'��r&�g�δ\��t��\l�� � ��j��1�o$�e�g5�]�ۄ��������x��y�d�칶�ұ�cy4���new�f폤�nq������f�!/4�u�m,�����nv��ƿolx s����b����ٜ|��x]���mʮ\�q���$σ����t��t��r��loy��6ii���@�lt�����u˷ӊȹ��?!)��� �ot���8�s�?��s��r�3t�&��� w�� ��s�~�j�u7��&�����7��~�� >�`%dz$��q!�͟;�y*xͷ8w�j�zb����i�<�����;hw]����֧�t�0��z�o�ӻ�%ax� �h�2�|ȗo��c�r?����'#< ���������k����_m���mu�v-����'߾p��hx�ap ӌdf����f�l�t��nذ��t�} {��5������q�핈&l�tfj9ot12�s�ru����)/1� e.��w<:v�� ��l����s��]�lm*sȭ!�`��n�zx�1i��g����suby��wa� �s�t_�_�v�����q[�������}��;i�'��c�t�5�vea*�m�����f-߮� ��p���*��o7��e)��,�z��m-r�[�cj�73��j�u ����g�6 - b�oozӛִ�5�imk���>������҉c� >"x�!27ॊ�h���_̶̊��d^*��d�z2�/�:�a�2���w�j����8�t_e�����x�e� kym����!�w���\���r n����� ����(�r_p/c镪�,�����&��� '#��c����ь�iӂ����&xʫ���� �2�ښ�l �n��w䰠2���a%_�x�͈z�k���������_�{nk�s�}�<�}x6o���, {�w70��7��e;e_�&� 5ĩ$�j���c6 x������?�\)��������ǵd��r���x�ek�x�v�d����/��f<���=~��!�x�,y�q�d��c͂k�е�a�=�n�pl넔�7�[email protected]�{w�i �s�x�ƥ�a�ڝ��������`5��v%�w��qt ����d���b�l/1/�z�ʮk$����jkjmw��l�t21��ӑ�d�@9u� }��d�������&��[p���j\��u� m*p, �&�w"���ձ���8��c<�po��w�u��~]8u攘�0���b���qd<�c��5�e��% 1,  ��t����l}�i�ef� -�l�4�y���2��l�-�h[���_��s ozj��[�ek��fu� �xua����mm{���i�?�p\��6� ���g��˘t-��zo�$�ub&�h�ߧ2��[��`!�t�o~� �� ��t5���zsﴶn s�;4�\j�� :g�?ma4�����r�|��p�*l�,5zc& ƻ���r�g��b����;|r{p�t����'e�z� #���:� a�x"��s����閗[:w��疣�lc�x%�~��g�b� �d`�r�b/����g����� ��6.1*^�1�jeehl�ڐ�~\����fa�h;�v�����o��}7:%g��zc�oy�k~�t���t>�6� b։w�q6��x��5�@� pw.������{� 3nҕ=ks; �?c�%�(v�vƍq��r2>i������w.�� ɞ"q/���3��og���s��v:�=��f0n�k����'l&v6�_��a/�jܺ�7�� �p�xr��q�%�� ���x`� h�c�b����#o���7f�ʜ�h�ϝ�p>b���,£����qg�ޗ��`��ҝ/��]��_�b8-�?>.�.��tۢ���w>a�q_�)h��d�����aߎ�n�ip64*�m�9 ٠0��%���$��/d� $��ft�h��a�0�`܌5�d�rv� ��ק�2���r����{/j�mf�u�����u��nq9w8�#q��\�.���a&m#�"uw:�0���soc�cģ����%u7�=7� �0ݕ�gõi�_���и�jih)x�����'.��srz(齕���b�,�v)�|�㩛�������x�<�lu�[ֵ�w����$^����� h��91�zg�gr�-��euȳy����ĸ�zr�9q�-��l�`���ة�~��xq�6�3� c��)06l2�mv���]�� �&�޴�5�imkzӛִ��}���qhvmh�����p��(��]j �'�b�uv]�t1xt; j.i��t�yr �ai s���{r<����h%� �s�,z���p1�����v���~eh�vf�eŋ� �vb�|�_b�e`����a��_�j�^u��,��i�9,�z � �f�6���d_d�`7�����q�e�t� hq�t ���^ɟe8��oz����kqp����om�p���2[�|ġ'�>��ނp���؝h�l괝;�к��9�d��n���g�> oyx���c8�ѐ��]�ps;�%m�~?������[email protected];me� � z�����>|�}f�ku��{t�r��&"mc���:e5���°�`5�~.祳'���/�s<`�k=6�#����̹���ى�4�?���m�~�l � a�s'�a/�o"��(��5�l[ۚ8����f� �aɷk�eg�0s �'!� ���;�njk�s:=̭ny�x?��b �ސ�3=��������h� ��\q_j-����#���'�/ 1m� ��� ���щr�e���檃s��a<@��}󀒬���'�|o���x�^g��ի��޺���o�w�b�tt����g���eam��yth ������*��6:�uզ�)q��wx<͡ �|��,�)� �!�y�qie���lff��-s���0a�2�of�pt�t�ky�e�m�ʪ�t�����qj^�0��̢"��tu�c �!݁t�d��l��d�#w֘�}��.ȗ��~��袑��&b��y���ѳ�s�pzn��k\˸����,� h��/��mj��ݙ��ls����[ c�l��e��dy� �@�m�t�t�����~�sx9 ��y� >�r���>p�^x#�ih?pܓ:zn��v�ٯ��t52_~�-s���ԩ�d(��c� ��g�駲��o�q��tc�� ���\��_x���=���lbn�?un��ևeyɥ�xs�o�ح�atr��/���$�by.u�����\s�4�/����"9(�)-�|h�����7�fx������ۨ�t��#� �`6�lrw�cq>h�q!| ���?a�ƴ�㥀۱st���c�#s��c���ɩ��l�;tָd«ho#?�|9�[email protected]�"�ҿq|n)�b�rs �p`b� �������k���w�=wv�$�k:<����1��h�`�]*��2捞l#%�}q����`2b����s�i�6 �0��e� �x�d����p����mk[��ֶ���mm�������'v����\��\�vsh�h���ߘ���giy{��zǘa7o��8v��^]��/r��?#����m�os���-u (rގx �7�b�l����-�"(7_����"�}i�hަ�y^����vl��'�n��m%ļ�zo���i�o��q�'l�y���/#a�)��gξ��ȝ �mi{�<�z�#� �k�"5;�� _v�� �e����|k��}rl "�s�*����d���d�_�r�zq0fr�q��3�gɫ��cxwؐxq�8��tu�8� �^oa�\�:� w��ˌ�/�i�b�`yadp�x�pn��ϛ��\|х���f�-h��zfz6q����6���l����i�����i~.����v�f���)��m�pf6y��iqxuxs�r[�v�����ם�ӓ=�� l�ա���ȯ�����r�%.. e��z� qy�!_���}�4е�u�%�4{�삓�f���3���h#�2;���3 v�����'�a�0_q���~ �qp�_�ٛ��m�����!m� l��z����;a0������e w`� �o�l�lz�p�x��r����e>g��'��e�� -���e�{�2����|���� {r����h(�"o ��:���a��=~"vg��c�(���_��� �ca�`�5�������oz ǝ�o)nih ;�u�q�^'�d�j��*9'�ؿ{�v���<7o�����|t����� 懡x��>.~�k��fr?��ծ1��p*��(���ma􆗩h߶��k���m�ndgh� � ����4�z�e[�z�f�q&p��s��nb���v*����}4�ٗ��#\wn.���_���s|��bvn�ɇ�zʄ[#�ў�o��]�x��$�� h9"���,��!��r���}�8p˔�a�p}��� b�!�n�&)���ky�cԃrmm} \�.oփeng����9 �-�s�v*/�x�s�k�? ���p�a<��v�r��/�l ��q�4�]���/�{���q��b�.a���=�[ο;� q�� �x�� �z���w��ƅ�]�0�yv�!g���b����ng� �5��bwzw�ќg? `�\5v�=��:��7��ؼ�)�@�]w�7��nڝ�c��y�}�k���s���ncp]�q�o߶�&�u���_y�ο���8��w� :;v-e�$���]]���e��y� w ۀ&�h�>-_r��g"l������1v����[گ��/ bu���mzv���m�@*n�.�,����r���f�w��s���q0ic� �=qhq�/���v��ߒ�!9��b����g�x�l����l�g��ݵn�kr`�{ ��3zak������l��lr�d��t�v�&��9��3�<'sm���ƈq�>�x�/�r��uj�����mmk[��ֶ�}!�s��[���s5u��h.����֙�9q��e~�b��q|.�/�r���k��a�Ԥ:�m���vq��b��*q��zl9w:zxp���~�i��f�`3!��������j�z��@���c�.��ͤ���o�^h�r���ga ϝpl&�{�ݕ |̦�ǫ��"����k&mv- �c��,��,!�燷?����c� k�j~e��]�-x̲�=l���-��e�j���s6{x��k�� �#or�b�}>5���ƈ����!�=�/s�h��@�itu���ao�������\m��nj����@�e�@��������d ȳ��ĺ檒5v`�z���6i�m]� ����vi���5�*��-�e���3�lzh��<񲤻n �c �/�ey�!s1&l��� �{����}�t$źz6�]�;rz.�1�r����a�~a�x�4da�d�km����jvmp8,�/��l��j3=�`����]�(��#��fڅ�[�d$�u� �u5i��9����~��nmt �����9���e�&)��m�>��&�3�� �r%��z:$e��!ap㢐_)&�l.�=6�j��k� �c���h��x)�('j�h���o�p�)o���l� i���9�[,��7f�x)�o���09l�:�����'�z����jb�q�!�at/�p���aʖ1����tanxx��}�ĩ?�4���f�[#��l�� =(����������gļi"6ָ�;�>mz/iw��y��l��h�t�&h�s�<������m�ϋ��û��կ:9��}�e�cpv� [email protected]��f����z��� ��<��|nn�������6��x`y�j�,���jl���h���xú�qoy��g�x:�5%l��_-���� �6o" r�.�nds%��-�맸��!o�{�z�v�hu�z��3ѻ&��� 9'�f�:/�4���kra"eq"��~������ u������k�f� ���� ��{�� |e�u$����r�l' ��js����k9q�8��)��e[dz�d�z��#�}�_�^v�w������z|�ww:&k���=圗-|;s�d:��f0ϸ�kޜ�h�=���ͻt���,�ٯ��ӄ�����x�k�i ݴy���rݦ���l>�[email protected]�c)��x�v?�ɭ�b�-�?�sz�yub !g� ���*�!{��i;�e��#_ly�1;������k�}�j�ϛ�}j>s��3��@��~f̀���p��e�~� �<�,���2��yo�!i��&�u��0�w�o�����r~{҇j:b������ފw'�`��‰'o�=��@� �b�nei�������� g�u?���d�c���ӣ�k:ߢ�d��'o�fy;-u�co��6�j�i��y{��ֶ���mmk[۾@�����9է��[email protected]�-n��uˇ���j��t.��;�/�%��� m���j���߂5/�$u ������n~�j�j��0~��vn�r�f*o�-���_�d��bsg�.��ߔ�^���~�^߻��h�͚x.���: `?����r��lǡ薵�,���|������{�������?a�m��������w��r�z!��$׏�m�i���ʵk�rno�q��-�f���)�lz��l��x �t�k��f�\�s��7s])��(�1]�?< �v!_n��qp"�eӑ�� c��l2'ɽ����%� [email protected]�:e��4٩�������ej|����� �� >sޞ��l����3��z�� g"/bѳ��a�c.c�-q��l�ae8�iv�ېqk$u��g~���o.�zey~����}=�]}��-:�6��̖�;��ߕxr�;惛�h���}m>�� ��jd�~f�=f�g����= �#!�>շ�h�e�,k��)�c��j�����a|�^��v��#e e۬5}�����7ӵ�oj<���s��}��}�ꍬ�����"/��g^���~�`cvӝ�ynv�-`sl���t䋬%z�ᛚ.u�gr�dp%sj�yu�fgg��%���;gh{-���_�v����������b��v�)kw�����;i�t��87 � �� �#�t�ӕsm!;�;�a�t���n �p\gg���^ᣨ�ݸ�v7�s��p����ה�nl������� �ϩ���� ~��o�@��)���� p�b�?��d5��v&�\�uw�:����/ln�x�75w� �0��)�>��5���x{dt�r�u���~ ����o��m�l�������t�'���eu ���ui �|l㠆a;�#�x �`e��m����p�و"l0`�_ 1og-���i�^q�[��%�a��e;����3&�/�>��9��i�xxx�dp1��m�����%�������q���sޚq_�g���\����ҷ��p� �ܴ���t�4'���o=��g��f�g�u�k���q2�[email protected]��%��ӱt� �:{ 6�g�x�euyk��%��=�m� h�p͈�w�ӵl�*hb���2�l�c�{ �v�����m�����mmk[��ֶ�}��s�o';�k�6 �ny{=m��vlk�^e)�l�҉_���g�|�c��'���nq�}���a��r}̝sx̝t8�-�p�cr�پk�ɉd3��&w�p�i�(���6 �����ye)����s�#�����x����:��d�cg����d^6_�q����b��z� �x� s��y' wo; ���l|���7���ե�y�s���� ���7u�kl:n�)���)�65ՙ����{�رo'�rg֕��:�e����cʟ��z(�y��"�� �z����� eq�etgn*]�zx�njdn��b1^�t�$j-.6ȩ'aj���-�)������9};��k���\�j�� �b\�� x�n�����a�!�qg������9���ie� ���7�?a|*�ary��0[����/q��^��q��& ��� ���1_�r?��� ���lo ���q�=�w=�k�!r^�2�-��h�|ag�edg�8=����^�i��e<�*�8�`�:��n$x��c��c[�[ͧe��#���eg��傿��e�l�vy��û3� v�j#�'�j�t|�����_^��i�ʀm����pws%���bq %]��7�x��h�w�[,���c�>,=(���]��q^��io}�y�f 3,w0/��� ����ͣ`h�u�� \�{xq`�yae�t���l�2ۏ�2tބ�f�� 3{��-�b2����ly��_al7�������m,�qq.ƭ�э�vs�ve� eb�d*l�c��n�u[�;s��!\�p�ϯeby *�� [email protected]���hu!�zv������`c�ty���r�u�xo��sk{f�1�d��y���u�kep��f ��ŷ�t���բaoo��[�&s�yv����>�n��.� (�����8��||���x�?��]�*d'e��%� ���y�wž't�|tv3i��yw�]k92!����豈�u�ñ�e�^�.��v�5�m4�$�b� � �;�������nd����@���b����[email protected]�vu��쌆����s��p���2mc��1=����������hä��-�?,�a��h���x�<�x cxhq�)\�2� �ixlbe}n�l�j�.m9\�?f����a_�7�s��]���.�1,�d:��z�t�c��������)��h'[�o���}�h��.���/��n�cl{���@�u��8���i����|�!���͟�n��a�:��z�t�υ��1��uy�5ac�& \4կ���a��%��nr� u~��}�i��,�3�� ]s���4������h�9��$���(�w��]�0��� s���:/(f��h�yo.��"%2�n�ȗ@��h�(�i�u�6�0� b�y�h�t��$�3���2br���� m)=�ae�u�������j*x�w�v:.ew?�m����i𖢑q��i�y����ь�d�� i�����mmk[��ֶ�}�����m�^!b�gsebz� ;�m<,�,?-��oz)�w��n��b�t�ƌj�s�� o��t���а �\�^��w��vd��w���}%�l���6m�!x�եh;"l���,�v[�k�ngթe�.h���spw�=�7⤞ӧ��pҹ�:��:�@?g��׏u& s�"�ܹ@ ���ܠ-%z �e������3�����&�n���&\:a¹i�(�?`�_�鎳��l�[�f��e!�gz �fzmw�z!^\f� �s���jf��zq�{"[�� �e>�j%���d�~9���f���g$[���unf��_%p�s�g8ir�e5{\�0�v���i�y�(\���t� �r���-ε��zdi�y�c�l�v�*c�j�s�8��^�b�rp�~mɚu���v���j���h���jc��w�<߼�r�� �g/��n�~ �� ��џ���▅�����p��,t����n�/'�nz*��m^���d݋by�����w�dߍ�s���dg9�ǒnfq���n�v�f�8�i�!y%�$�h �[���j�k�烨w&\3rv���#7�a ��k����f� ;/��,����?ٳm �bh�t�h[����f� �t�_�*�! ^1��ekqmb5�1ٗkhiu���:�o:_dg=�yh�j9��,8�0�»y�? ��x��an��r�ty ���z�4yij�jv�j�.la҂���/k�6x�ٹ�)�[o��u&?�ѵr:mme����[email protected]����d�t�f `g� �ʶ#��.�]iw���pvuw�'�����j��`�x�=6m�t��mc�v� c,[email protected]"j�`�f !�%�h �b�t��t*����}�������z���?�,�zk��{߽�{�>��j��x�=x��'����veݽ��?j�'�*�qux[tf�g���<k����.���g5���7dk�u����s�&s��� � p�mo�&�ne�k��(�]`� �ك �“�!���� �/o�����k(���0{m�o��m^zq<���!nr�f�;�u��0q5�|�i��v;���~��:5�@��ι����)��ͺ�\n�e��c� ���g�j�� �u��#~����\�o q�vi���8*~�q2�g~"��vj���ވ�ix�_��'��t�ٞpk�m82���rg6�ܿ����~�&^��[{��^t��/@��7�̽~x�-g�|���b2���i�ɉxwj�'�*�nçf4q��flb|�v~�#mu��꥙`^c��|��|~zc�c����t������#3st�;�:⮷�p风��i��[ ��5쵆�k:�uõv����� ���*c�ܘv�t?���j�)�qc�qt�y�!h��up�ϣ�m��y �}�e���� u��v� 2g�oh �����nu[�]a�� ��է\�8!rs[rsa|�po���ajmذ�mu�c�[e/�>�n͛���-�i��b‹&h��u_�&{����8�"�'oء�b븤�)%.a��î�������g_s�(�[���,v��tq�1,�q�*�_ �#l}�k�������|����f߮�d i�`���� ���au��.u�k]�r��ԥ. �s���q�c��njh�?��e������2��ct:��h��ķ���y�/k�5�c�k�|�(j9`y}���z%�*hr.��k-n�;��q� z�w�|�k �'���j�,�o�^! ���n���ó�w=r���b��j ��2�`4ns���� �a|�x{ll���qg��k�����0݀�)fn��q�!���j ��[�g�z�8��r�_� �na��3�te�9m�=(� �.�ed��s�g2��ttr�*�v��g ��3��!��ާ�/x���h8����0�i�i��"�6r&���,���é�t�� �m&^���s�5�~�pf��5�d�x�s���&�~c��'rͫ�h7v��n��zb�c�i�:^��f!���4'�_[���$=�g���y�ѣ\[email protected]�� ���b\���oox�n�i�_6�^��� s��36�k5�� �d����st8��vp��;h� eՠ#�}�髍�5c��d�!������ګ�c�ݖj���o�$o���o�^n����y�����.ﱬ�̫�\or�vvۉ>eܾ_e�w�wg͋>u��x:�� qz.�����[email protected]�zm�z�w�� ����2���!���x�� ���[=�]�u�� ��jmr����e7nx�����;p���,�g�- z (9h5d���2�� �8 nf؍�)� ��i}zz���/i���~rc�]�jx4ܧ���α䤤�z��qɵ�\@[email protected]�9҃�w����qp�1|j��g��_��s��r�h������ �l̴�-w#mv��2��'�b�dq1���=:���n�.j4ޡ�d> �˙��|~d��tq {���q}s5ѕ@�x�)bu q�8h�e����m�h�[email protected]��e�b�@�:�����������k��`�ww!��vg� (������l�;u�w}r�!�$i��fnn\���  ��jĵyշ��=��������9p!�bp �۱�}�k�~�ÿ���������j;w܃�-�n�%j5 �o���˚2/�4-n9`a�'�99��y��#u�q �2>�ka�o���e���z5�v�5�7� ?v��^3xg'�k���orx�\� o�9e��'-����5�9h�_�*�%���>�:=�e�j�%��p�e�o�as5 �$�>��t���؃>sp*�񏁖 ���ݒ;��uq�#ʽ�����y ���_fi��c{��h���t��2a� s�� �bl��ō�;ӊk�hn!|$tފ}���^��#��rrh5���� l�k�׵k�v���1�j>�'g�gx�_���v�d���[email protected]��ve�z����|�#q�2�~ �=�#�zw�pqҙ�`m��r�?��k�1��ߺ��x{]�r��ԥ.u�k]>r�q����^q�d��10j��4*�b�8���k��o|8jl mrim����s�n;(�[email protected]�_$��`��_� ���g0�}�3���#��sݢ���xd�}�����?gt��w�2jft�5i�������m��$��4��߈�����`��nf\�x0�i�c�m����@�nt�)���l��8��!^hes�[�:�"ۚ�ȭr2]�u��!x���[�6�z���������xnʻ/孓\ ��ŧ���%��%�6v���x���.hl�����$�hծ������q�o�<��vvى;u� �e~��f �k͓,���"� q�k}�q� �f��8��d�,����=�����w � �:z��gg,����f�!�����x�줦�wj|ė��f�r��v��d�4����[`��^eoxj6ᣀ/k��u}�x���1nvp��:43t�n��i�^)jr�j.qac��ap�t0f�t�_'�[��w�>��6歖[�^���þd�-�g(� �_&�&c�*sr��qp�!����&�eq��c�p��î�yا'��m���wt��pγ�s�-"�j�牶h\���2�ťz��'�p�<�m�m�}���i��*�* q�\�hz��pϑ1�r\���kea��[����v�ue�%���f�=r�sq��qsul���.�ߜ �k �����}��.e�b̄�:�-{c�[�k�k%����-���։4��'�?qh�}���nb";��"�~�v/0l'�h�����3og�amui�9�ơ��~�>��2/��h��v!.����0޾�z��.����u�yaq�i�]��ny/4yk�ua fv{�^�m�;w�u:q;�"�m���ސv���k�ki�?�ig�9��]��x��yjb�y8]�\g\<@ԇ��<w�k�w �}l�vs��i��� �_�7��o�ɺ��ue8�%��'õ�̓�菎��b�k��m��2�!�k�/kv~o�גܔ�~;�t�(� ���w�5`�q}�w����e= �[email protected]��{�鎡z3t &���\��x������;ܝ�n�ul6����8���0�`s~y.��ы�&�a�9���hs�-�q�ܭ���!��onm��u&���t*���1� �[q��^ae)�j���c��ŝ����vg�pn9.l�n�d%[^��ڼ� �u�{|�����|4�r�a|m�ngj�p\�01r�%��p�l��ƃ'd٫y݄0gʕ��%��z8�rł!q���%>���z�k;��tw�2�8���q϶(`�m��w���k����])ۚ�ud�ֆ>/ُv/�er��7�x�a�z�z����&��������d]m��:��m|�mj�2���j�(zoy��o�8g;�|�7k���6����i:u=�8�i6?�q7�viι"e�( �;e[��m55-���enm��� x7�s�z�h��mc�qa!�d�yr�:&r���w�� �&α����_s���������zm'"c��ȼ����j�v e�eѧ;x�qw�z���oi>y2�wub���s�a�j,��bě�a7a o7g�6j�0���?x���ץ.u�k]�r����,}�}8w.��乲�?�<5�4 ���j�/ⱦ��w��ǚ�g˓�˪ .k{m�{(���u�a����n);lk���\|ӥ��j��ڣ�>���m"=�h��1#��8^a���4�g]�. u���z/�_ �����rt-�*��"u�l~j��ewm"9dgc1�\ 7z�pō�թ ��~ �x�'z� q�jۉ���y�25(��ɦ�3�鶼a�*��]4 {�lt�c'����ja�l u�;l��u���ny� �ׄ�� $��y�'������y��e3� �_�np��?g8%���x�jw(i&�6��%�1���i9��îq�o�k�mƽ��w�2�r����� �l�w#�l��-��y��5ŗ�g��xo��m��}��qur*�n��x;���oc�h�㶂>���� � �`h�u��̻���8_��#�d�rul�bj��!���d4;�n�s%��d��΍��um��/���y�r�iax���s�ɹ���^ߚ�cdtǁ�k3��u8r&n�r ��k���7���9w�~�i�d� [���r;u�p� �g4�k,3�\�8�j �����a^�-����������.i��jf�z8��>} ��,��1�t��nb\.h�.a��q��ߞ�$f'弔�"t6x^��tɜs���.�߱�� z�;��;5��я��h?^��;,5�&j:y�qi$v�}%щ��*�.i���9ѣh61>��9�i|(x�pd� a�=d ����ٚ �e����d[2�0����k��: 4�;��j�5��d����ֳ��)���!���ze���bĵ��~�%�;;m�a}<ꟃ� �a���p쓹,�knt�����ot��/��=����7���k�x� ���z_nh��''�!��sg>�x��5a�jl�>�������|�gk�6�>������>�=l}fz�a-cei����l �y�3�[�ov����>�$�'�s �(�*�~w���ސ�k��ii��z�-���������/�[���; �t�_t�v���y�=.����m�o8�go��qk(k`��)�(��צ*`[email protected]��6����~�8�7$!ű ��c�k��vj���t��9a[�>틇m�ϸl���e�a׹�³1��s��en��pй�jv�mbrb�g�t�:�9���#�o>]�o�a�-�d�ݡ6���kd-2t�xҵ����cg_lh�#�8��x���o��n;��x�������'�������!\�\�yaw�ul�0,�w&���^�]��s�k��b8��o��ғ�g.y3�ċ e����l����� γ��v�u]20����r\n�?��b�kz��p���.��o��w ��u���r��ԥ.u�k]�򑒏�n�j���ar� �����)�ra��/d�s�2đ���'�~>մfe��l'#��ѝo| � ��e����]g�v�hp�"n..(�'�n���|����d��a�� �4v � ��a#��q�@�`�5�h�^kjz:�����af�lq!©�3>i����n v��a�^g4a"� /�8׼�ϙ\ieő��v���r�*o��g��#[�nl-jh�st����kx�a���2�v��-�۟��8�w�z�n��ٿݮ��&��4� y���z�������(xԑ�f%e����/��l�"��������0��.��]��s���gp]f�"�g���ڍ�a�k�w�1㉄��n{��w��mo5� cc"go��i����@/i��a����)�� �� n����8�5i�mޥi�[ f���%g�\l^%f&7�[f76�� *ԕ�s�v���:�װxi�����y#�ma��������8���h'����|<�w�g|#�:¢�n�y-�z ��u۷�b\,ū�z.���q��"� b��,ϧ6��.���e���th�����u~���a �* ut��d7r/�>����"�ɲ���,�ex8�d���^l�t�;�{�ǘ�3���s�3f���j���!��㙴kҋ��]�x|���� �' ������r/�@��w���i��)u ���hx���p����*=�훁�#�,� �<�ԑlu�m�j➦m�m-�8\��wj��a���������]�1�ex ԉ�i�']�˽��t۔� ݯ�{)�0���<�i�4�x���� ��p�p�θ���w �j�ۆ�yuq^���/o7n[�j�ot�f����s�8�޼�2���؀9��l�-*����v����k$�p���.�����ĵr�p� ����f2��� ў���ȼ��!�p��?ͨ��������t�t�!�e�>�}轊��h�2��=$�t)���ᓨj{s��h�ul���x�$k<������q:�m��mg�6��m/u�|� �$8��z����n���{�q<�1�-i�ɦ_o�vd^���� ~�=�-ܭ��x;�b�ۉo�� g4ok���4w�y��w����6�pl`� npa� �~յwxv��������g;��b�4�(�?h�����^��cq��� ��lch ���a9̝�����4��6[�[a�l�x�;�� ���.�[dm$wy��ގ��_f�c4�i��u�؝��!>n�1� ��(n&����������{��?'�,�.�jx����{8���8rlxm��_o�?o/�|�e�����w�a"��=��7�<�)�����\0�v�iڙ���zs뮄���a��� � {���bǻ��t�74w��g����u[i�u|����7������`9�3��/߾�rwi�x��t*ɤ�t~��ij���3e����1 �f��$a �#�� �7��`0b�@b ]d -hhh t�{u�}뾽w��.¤jj�5388�[�nuk_w��=��>�y�n��r�����k���i$�(�c�g=��c׸�� x��_c���x�m����8��}���>@� �g���'����������'~�!5���� �i��0f�[email protected]�5�w�d��b �@�,`ǚq�q�ms��z)�5��cv��yzz��[����2h*�\d�q �"6g�1�)��!�-k�c��[email protected]�cd��<0��)�b o�z6b�u�~��� �j��)߫������r�g�������� ���f�|��t��u�z���p���?��. _��i~��fh����zb?�`3�����}�rt��c�� �����g�`�5&)}�/d?p}������!��s -�x6q��� a����a�bj�� �'��#��?��y&oƴ�ej �c����x �-�p�0���9"n���� s��y��2)�÷%t���u ���:\�{������p}im�%��p#`��qf���ca���c�|�����-�>� cϩ$ ��y���� �dά#���� ��]�t�i��bc'2�b�8�j���7c�s�s蓝ab�6�{d���w��yi�!��s�t�]��:')��bz �lmу�~؋o���ct7�m��s�w("%�:�ש4���%5��r�rz%�ثr��ye]�as�m���#/:�a �e`��z�p��!��ro�v�[email protected]�={w4�o��sx,�f��j�r{ko�kz���ykooy�zֲ���e-k���so��w�vmvjl��ŵ ��^�u)�����ø���jj/��2���� ��j�u��to�����:lhu�w���k�/@v�fc�ej�b|��� v� w �r�wh�ra�2�uwtl�:�m�nb� b���j�ob|3c�bt �)��p]߿� �$r�й'�q_%�e�n!4��"j�p|g_d�z!n��zn� �i.�$j[email protected]܄���2�@!�rv� �4ïc��(�c�f����s2� � d�a�0� t��wp���|3�/"9�� �װq�xe0�(��p�z^�o�#�� �����o"� edi�f���d�����^��nc�d����t�ޭo/�z�woo_ڏg�%ś8]��\���$�tҿ���}\����l~��q�}ʞcja�<�%]sk�d�1/`td� q-u�*�����`aӊt3v�')f : �lq��!�(!��!�"\y�)��^�#�u f�3��}kw*��fh��� ����9�j������~�v38 �r�y�4�6�-�u��d�4.3�k�� �>)�j�v�`�|��ů�r"\avy������9��c���r|�_3��l�a�-]ʾd��b� �h�:pc�)|��λ���ց�>=�~�ۛ�5�wq5`u�ˁ�z.�4��|��a����\\"٧l�y�vs�fhխb�k �ik����o1�sȓ��@i����� ����mb|x�3lqwi�j�6' )���k����� �o���h��y��㐼 �($��uꥫ�z���@�}�h��u�oqu�ثqh���8���5�]��̹���\�6���� (���� ����>c7h|�ڧ� �|�����b$�1mho�d1��#���_f�*a�� ��g��?g�1`t0ok���ا��6�v!>h�}�)�v���_-�͂�����՜sx'p��v�=��,xf�jh �:xj�bow�m[$zl_`zg��dl_d� м��-|�����j>c�g8��$����.�� &���ji��ag�2�$�#���m�hh��ubԑ[email protected]�ި�)b~%٭�\��u�u&�i/��v"l��5 u�n]��d-_��9_`h3�7qqg�9�� lg��l�[s�?e%�v��گ@v�^h�#�e�f��ܸ�w�j�vqr���]i�udu%��0�d�i��)> �w(�;��:�@omv9 i�b�������x#�g��`3�j������a:e �x���h�(����_m��ma�`}�ia�e`t�ws�dq��4���fj�o���~�\����k�z�x�@#&���mu��f5��[�ʹլit��s�m8����}�x�#x#��hv�e�0�^�� >l�illny*�qcf%��p񔚻h�����g����6� ��@��3��q:-�8g0�l�_�������o�|�y�(ہ�9]�a�t��31c_,r#]�~h�,ob�"�2v��2c��>n6�җ�pic�a�v"z?�ט*d� u얗 �)���i�b�v�� .0nqe�����s�ċ��}��3�v���2�? �j�8� ��>xĥ@� 7� {����,#y���f�d�j�;�j u.����������e-ky�zֲ���=e��o�& �).`]���}�h�8���n��8�`c�l�dn�fn�d7$������6��%k�2� �sb*�߄�b(�h�",ԙ%� �|<����7gֆ8ؔ�3۽> �d��بǥc�c�p�)l3�ۣ�8����ʒw���(2�2��o�:����'�8 ��w��c�.b����; }ت���&��/irg^��6۾)�ܑ��b�ka�>�ߚ�?����{��k<7��af�%r�)��"�ӗ{w��<�6o����� �.jj� �t��^�������������mq�����(w��<���\�s�$_5�-�����>����d��ͱ�|�8�q{ � 9�k՛h�{��;��ϻuů ��w��|��� 4l"���/鞠� ���1���暬ymd_�d���-�9.h����u�, �%a�h�/s\������tcxz;�g��fzf_�hf�i �-�g�{��������yy]�^�xw�ޚ yf����7���s���\�&�a�h�2�7u�w���s�swl�c]��bֿ1��ο� ��g��,o���%0'��%~�����}�����w���qۚ6�9ioqoz���:4��9ŭ9j�r{��d6�ʫ��bqs��q�m�ld hu��5 �ȵi��k���mo 5߀���� .��o�2y��~�o�d�%���g��[g�ab�l�����_��y���g��e~5��g�́�k�i��5�j ԓv:�e������p߮0(�*ؑi.j�n��ۛ8uf��ƙ�_�����oݖ87���&f�c�)�[,�njnֹ�s�f]&[email protected]�v|��~�y~t,;���x�m3��ؿ��ߔ;�9���u9��"����ʼ�l���=y��ui~��a��y���( ���&t=�.��iq��zyv���-a��qc�[ӗ\�n�w������yc>蹷e�/'�w�`��gvg��w� �o�n }r��@�v���d���h^e�爵�u7�ՙ���\��$�wb���j�ttp��� ܚ��ehv��$fkooy�zֲ���e-k��o�^��ki!�j�h���ez��__��.����n��`�mk{��cw�=� ^���e����{:�{��{���.��yqǡ\f²� �w�����ud*�tr�a�<�����v�{ۻz:?�r׿ٗ��md�x_(g-vw4�1^����ގ����l|�3�9 � ����/_��8�3e��f<#�y�.k:d���l�ѷ�ںf������p���5d�hԑխe��y�� � g��`ܕ����䢣~g k�vԩ��%_�̓����ݳ���ofш͑pu��kտ/ :'��'��� �� ��e��� r��xtxu�uzѕ�&�)��|g-�.��5 �pi�a�ގ�$�*$��=�p�2߈3���ix �j��w${wdw\�}je�uy�dgv[w�s˺�g��քˋ�\���h���"�!xje���p4gѱ�%x�!����n��eb�]�xz�1� ��� �p�ׂ��\����q� a��ov��*%u ���� ]�k�sa��=�՞����l�uz��ơ�9�cz$|�0����?&=q��\�k˺w_�|���g:3�te�[޾��s_>{�u��5��<, [email protected]���~5�io�%g���@�lo��y��ձ��o-ݔp�u��kձ���[ma�qgv:md4��jo�( �s����?�lj�����w��x� ���� �g3/�e�u'�/��]��r6>�}^0�83�q t�"tȏ*�z����m}��?����bwfw�� ��w��z��΋�t|�d����/��n� ���\��"q'��z����2���7��'n�� ڰ,@���j��q�r|�we�}��ݹ�;;>������/{9�n��@`�f��&` �4��qlj��}˳�.w�u�]��w2�����l�z �e��nx�yc"�u����=�2*��k2�2�ki<�%�"�htu�w�ks�4:�tp�c�}8>�<���t�*f�� n%ެaր�b����@���kdחvi�i���c�����o�>�����?�� $_$`�¢ �����nk�jnjx߸��`��9�� 6���ܓ��v�;��{�'�/��x���c{g����/v-�i�tx�?���"�5�*p�<5�l�x�:tan�*7��ix�#v^�|w^����]�l�x�?�d ����1mv�:%(c2� �f“����k����9δe�pc� jm2{�;�ҙq�xc�� r'�݇�:� 8�vuҽyq�r*4��@-ti� �kx2v{�۞��e��w���:ḱ �r��j mn (09��-��޽�����gv����'�^��"�uĥ�3.^��<3dž<����:^z�l>��<�u��ըu&f�05�u����d�z�{voי��0�n ��j� -�&�-e\���aeߙ�}ӻ�"��ͱ�to���lx�3�ҳdo��|������f��0f�xd�nh��2�ӗ1�ef�ec��>�����:_ �wu������̐��[b�"ce��*��x�|��֋;w\tю~詋��֮��x��f )��[ r��jj�p��׎^����>������ v\խ���c�df��o�i*o;αl�jwǁή]��i����]�ر��{;��� �òpb:��e�\55-j�"��xt:l�.��\���n^� {���뾘֠��w(��l��9b�,y#��v��]��c�ф6�u\��r�n*�c�;��0���k���������e-ky�zֲ����z{�=��k�ò��a�q��o.���� �6���q��;����΅�g��� 8�y�}0ø/�� ���ig �*0*�磖�z��?��cv0i�sl������q*�i�e�l{�[�t�at��!pa�1��snnċ�`��g �hy[ dבq�_�e���"fe}�j 8z�b� ǭ\��'ni_ ���yn�l1���5�c�;�s��@me� ȩb�o�peh��� ��73ћ��l� �a���$��� �j����z�it�����\�����2 �uyw�v=j&�,o��l{ȳgcs82cs0���֙�y-�o���iv ��mkn��l�רzb��oji վզ�jm�9��ȝ��/"� �*pkȯa�fy��2e��ӓl�b�0� o�͍���vv�jf̠� 喩, �o����2bs�d` ����ddoyւ�u�վ c��ά &�̨�9o���7fqr>�b�|`����0<�c�y $��a���yl� k�όe#~~�͌{ѡ���"e��v)�3�l�2��j���]������ݵ\������s��7�v��@�e j1��bf�3�;f����0~#n�ƙ�0s�a��s�7b�l��zc~0e���9)�b�yʓ @���`�#~����|���8�;ca0셣v<)�a�jcq�2�%&� �1�eb!��q���a�n<�3�ydd�b�(��ѭtq�v�7�d�x(�{đs��p^ǥ u�s̝2�s~n8��c���x}֙�����5o�*��b�y۝������{�;��:΂t��[ŭ�u_���oi��ĭ�c����s(6���e��yf���r���n��ii�s�:����tc@z{u �0�5ڿ}��b��v c�t�eq�q�ta�i� ����k��(;e�e�7��d�>�7���p�uk��i��y%=߯i��6� 뤪o p�i!&\g4pχ���9�������?$�1a-(f��x�1�z�n^`bܲ&{�u�=w�p9�0�(>��� d�y4�.� ��|��h��|gз�ٌ�ej��zh�a��"g3j��l�eþ7�;��q`��5�i*z�i��j�u�a/����?�}�=�~( x��(gsc�el�r1)�a;� �>ߞ��b�[���^��(����4p�t�f}{����������ost\�!�*� xz[�4�ʾ��[hol!�.2���n� c�q� ��#y>f�  䌡"�ut�noa�� �$/���n������ ����5�e�5�_�^�� u ���y������} jw)�af�q �,s�5�\j���[ k��gtd�;�fv������8s:�f\�jp�&��q��p<ό�m��7��^77f��x�wg�yu����3���\*��* �b^�f����=�o�^o���n� eތ唈l�i��y���j>u1uق�s��1tъ4��eȫ��c���ej�v}vxї�pkooy�zֲ���e-k�{��f��'o�io[g�ߧ���c�mo���u����e��1�rf�"�5��}��iq��{�68lؤ� ?r��q�v �ed�" kns7�����u�t�i���h �]j����z i�\���;�&4 �[rv�y�$�j��@7�{vf8m`��z�gro����j��s>l� %�**tg�a�*�z"w�h�tͭbn'u�m`��i i�g1�r*[�)h25d�@eh5;n�fkle���j�z�&vd /�@cip�ϩ�uဖ��9�rifa؝�й�kbv�fw6���\ s�gaif����q]�m�� ���<�l㯩o��^c�/�6�|{�m�~ߎ y#ۉp�_���|{b�w|;�5��ɇ ��"����%�4���d��*$�� /��'k�\w`�8�]`�4�����> ��n��ʙ@ډa��f��''��� ��a�±ś�=�/������wv�ˆ� ��<@ ���ls��у�#���_�焭j�f���t�az^�`��d�f���� w.x���<�ppc�f ����^n9�a#���y�����³�m��í���,wv�j�ē[_q�h1\l�b�]� �`�fi[��cy�1|���s��.����[�%|�÷�9�o?���c�i�͈�Ԩ�^�"m�ֶp=l�hw�a�u�a��sn>(�����n {$q�8�0�k`�aְy<��ut0g7j�p%`v�h�̩�b�!y���\���d�-�k1��o �{xîpy'�a�� �!5�~�x2p���3��8ɼ�5ώ=�ow��s�ru�7��y� ���y)�*��`#�sh�<�b�v_�t�im��f�o�3`��c:g�e� �c�ȏob''2?�hk9)8���]c�d �3n��, �������sj�(��g��9̀���94©j8d&�ir� ����1r��s8�3u� ��5������~��y^ɂr��t<̚^o��'ug��8n�di�؝d�1`��{ �*:'`̵[email protected]���aը ���e���� *z�u�_?�h����p�o��s~�|�ry˷k"ۃ�o�$�l2�$�l2��|�ey$��z�w��_����o�8�v*v�nó8�j��,y�~vh���δr��b!� ��f9a�cn9�g� ������n�/&t�z�;1�m ߎ4� �/�%�6k�,�a�3i"2�r��k^��|)��؟ !rp0��8��@\�t�\���$ό{��t�=�x.2_,�k�d!�2��^�x���ɡ�"�s�3y�@9�8��1f��(����@�����l��3f$)�����\1u1���d���m x]uppg9y{��8��1���������*� �ys'��m������y�=qn�vo=��9q�8t=j��)� �5-�`gw�#n�jj�x�ɝ�|;q���tċc���.ğ�v- �a��j�⠛���6��iaq:�x m�gp�7&� ,$��!��̰�5�j�b�(�k�6w;�0z��5e�ɒm�l���.������`/'q v񐋀�\��o�f0��j��f�v�\y�{������ �s ;�l���kl�ϧ�~�a�ǽx�ro?�i)k��=��dgȷ;�i 強�`l���w�[pz��q:��ַ �b��"e�*��&ki��y|���/�!���z�����[email protected]��k�;��g�d0�æ�l�ȇ�yp$�ݩ%qpu�(n]�#����tx�f*zh�{.m:r4ز!  9!ń�j (b����6˓������=>�;v���|�b�����e#n��� ��%u4����k�����w�1�^�td��vo0�`�z��,��]/8n��ȸrx�l�� � �w�`!�p�j�|;r�x�l�v�=�����7s�oc�ղn}���ug�}�\a���z�^ky�h_��(]\ijn�&� ���� ���7}\�˭l���>�4־��:�� � %l���\>x/�mb�u,�%k�v�k �l���'�$�,!�ktd�mn�5h �]�ǫy��l{�\2j�zĭ�y���u�r,�lc���}�*:�ժ[email protected]�`ƫ�kt5�1n� �*� �h��f�ȷc����hdb ���k��c��ѯ��h�'|{-̇{�-�1u�� �q#[�;�ogj�5c(�7g �r^�20��;!�z�qk�f|,�(x 9�ݮ���b^��8�h�.1j�x>����8�[email protected]�%rz䱼.�u^ q�odq �� y1���a����юg�u奵cg��xc���x�b��2^�a0�o� ����� � #�$ ��]����1�d[� v�"��ƿ�()�ߩ6l�s^����'���t1��jc�t:c��#cg���m}���s���3�l"a������i,�{éb���en~�u�"eyk�awu9j��z�r:t���xv��>�����miʷ��c�!ǟ���"���#�&��j�&m/����r8�5�vݹ�;!��1�#]�~��ay���u�7��> jqo���=te!g �sy���j$�����(߾����dka��ؑ]���:� add:f�4j�x���� m���)i#o�o�^ ���_� �61ި�5�8���sf1�]��o�fi��9l�����!hu��d�?����gɶ`9���rf6��u�c;���s9g��t{�:!uom.j\3�x��l�!�e`�b���52�o�n������djx�v���/hkq�8�ս���u9������c���j�dea�4����|��m��z� ��u $cg�.�۷}����on�.ej�{h�w���k��]�j�}�6g?z�x��*��"a��-�7�rdz3�k���nm�������bq~w ��z�|{a9y$ �d��je̘/pp��&?���mu��:�trr�����=z�e���p���^�1|���᮪��� tq��zxn�z�ji 'e�qũ���a��c��r�t-�j��!�sr��#�ξ ;_ w�|;1�h� n��um��@o�m���t�z>����?�x����djpss�:=�ώ���l�h�ַsc%xy�$6sg�$њzljo�ֺiu?�r��֓ j�j�v�c]z���f��e�~ĉo.҈y8� ���gf��-wq�c�����������ƴw��e����#���(�g�r�vcze#�>��a��4��-%���snˡ{�70������#l�� ���撢}��h'���v2*zr� ��b�1q��~x��t����޾�sg�,v��_�&�m�w�k#5.�i&�d�i&�d�i&s�x����{������:�r����ebuu�γ����~��rs� a\������<����|�8~�z�eb�a�t�s�a,��6i���,��|׼��א��6��b=զ�yq �8p!vy��g���!���w�t���8#:�a����sa�;�<����e^!!���,\:�ʐ���it&�z�a�&ra�i�e���d�ȶ�g ( �\ ��1-oi��o�'ǧ�v�o)>��� ]n �m��e���b3|�1|���o�0|�a���ʏ=<|�ذ1#im���m�k��&.���}c��{�և�x�5g0`�3^# ��p�o�� ǯ;棪��'�"��t��%�����ܪ�(7�2v9�d��nt �gbߨs՘��5���r����ll,ߞ�6>� $˟�!=9n� n���.j�#l5`�<5�a�c�h�gy�� ώ3�iʤ��_zw �]j�d>�s�5 b�#�7qh���xej�:�&�&$ 6h��h�@�w�l�=e���5�qqm8��?�_�y=b�q���k�o��xoq�xy�rdhc� n�m��e�`�! ��,�j�s���h�ų͉�5�p�sv��p�w\���|�]d5��6s�fa�95���󌫌喝���cִ��yb �ː2_��cnj?�����ai9��j߮�5h�f���6р$���t����oz;:�o����%^�2���]�,u�0*�e�w0�ň9�r�wn�����p�n�v��2aϑmo~kӵ7|8ʷ���[�ξ%څ�f��ќ�k�𱩆�ք�ij����6�,p���֡��:55�a�^ �р as����t{,g���jr�g��a�i$-�g�,|��#�ŕ8 ��r�j�r���7ŵlr�aq�`�k�fbp�\z.�.�!��b�!��h�g[�e�r���ղ��@w��c�o<0���n�є�:rp��?�'���q�����h�p k�[�ws��|�94��l�#��p�p;d�,�1|{m=�穉 }���v�2�o�7k�|��p��f=�����u�gn�d�i���c`5wns�f:�h%�����֗��z2]��3i�-�vӧb�d����q����x2svi�u� pustr|��v��mխ}���l�*dư�bb��h�%]�uh�d�i&�d�i&�d�qe���&����w��`��~v/y=qi���� �t� qߨ��h,��iրr��n��u�x�n�{b�������vyak�c��6�f���6#r1���cv���p"� ؈r��t��%��x�"� ?���njt�`j[ф�c�h벑ær6h����m������a���rx.x9�)��6ss���t?3m�]o�8��� �x���,�����ȋ����lyl�e�v�|j��� ��9�x��ksq&tf"ů����xd��1����s��k*�t�pv����8ķ�!�ž�b}{�k}-��i��q �@� r?t��[8�?<����%d�@õ'%�}��ɿ{��"�,�!�蜖�j^��j��r��h'�=m�~�r�:x�������~_�;���/�d�m���#0�� �twq?����o}�?l�m �eԗ��ޚ�������f�f s�`�ܥ� ��, ��r>��v/�z�����3�t,6#u]��ɯ���wߞi&�d�i&�d����۩�r�]}}��-w5#�ΐow��m�� ����v۟ϗ����� �:��z�ȳ����!f��ގ���u3�|ȋ�p�heń�ķ3��͟<�o ߮�c~5�9��ɿ�|͌�7�g���̹��ۋ�>�o�x�ae!|۲�l�u�m�m�b�]f 3��mx�p��e*�2p|������*\�)��� ����:�������'�v��m����yz _.t���vܕ�l�����l2�$�l2�$�l>�(˴��6�t����so]�p��bb��!dib��.qkuzrf����rmi gp㊍v���jgڋ9bro1 ���r���̸�����y�g�0j��bq/��r�"�ަr���>����c%�{\�dr�qdenxwi�{kŧ$͐1c���w>���n?�r1�;�\q��g�u�b���u#l�ٔ]�zj;,�{���'o�`�}�_�cte��tu��p [��*��a(���:p*rj[����j�*�/4�_2�j��d y���a}���� �(�];�x��yq*�r�u=, 6�5hv�k6�� xe�6�h��]���5n�p��~yxo)ܘ����#k��ɲ7n���?��:m|{��˰r����o��a�n�* v�����!��hxt�>f���0.g ����؛�]%�ҩ�0vz������,#uk��kj��)f2a�.�ʩ�ko���w�. ��'v4̫��如:���w�b� 1�e�v�hw�l���x$t���<� %v��~y�go>�u��[email protected]�a��cy���a� ørq���,��$�l2�$�l2�$��!�]�voszwt� ������q17n}wmr�"�q�bq��?%g��p�p����o7�f�c��ѫ��™|�ǎ#4��f��9�o�)�w�t�:� ď~�r�x9!� ߮ ,�ae�o����g�t� ���|�v'f^��cb�8"��l����0e6w�.�{���'mz�‘_�����rd� t���a�� |�b���o56u�$d;�\1�lt�g�e��!w�o�?�!���4z ���r�j˷���� �`���~3�!���������� 0�`��ƽœ��y���w�� ��5�x����ȗ�s� �w߮�9����"�x�}��h�ݠ�pt q���*'�7���� �paoo9�1x�q`m2���6c�����>��g�]�39b�>ٰ��n�o�l�]b����ń��v��."���%���xo}�����d��ksr�z�vrh�n�:�d�a�th���d�i&�d�i&�|rj]uzp��ij���;��� w]���2s#�e�!���cpk����#�yg�ǐ|s�b���ub��8��p��]b�0���la��-q� ;/8�5u�\�q �}���_~9a�-�r�'5�*u�"����( q~zk�����كp�v�h?�p��d��.j��#����͟��,wa�%��n��x�g�� ���\y*���u9�����d��q�t�����6�*�� 2�]�7}ꏎ?�c=r̘�f��a'-a��ӫ��ȷ�חi&�d�i&�d�i&k�#3c�_ݷ�ݧ���w�c����la�g� ��og'���o�����gf�j������g�/!��x�*�%��cph��.�a���3���v���[ ?��x�e}���x�?~$4&4*f�2���v߮�`廔�� �t�����n��=��c�b����d?��[^�ol_0��;ff ��,mi*�bw�r�*�2�:��bb��rt�}�k��ˠz�2tqʉ�p6�j'y��c_�zo���`�9�s�n���l��vli��������x��`�d���c��1����q�c�i����s���1k{q�s\9ʬ��īq���_<���ӯ�d�7#ۋ�!�'�h��p�t�����'3�!���bgg�w v<�h���в�۱��7`�x�h=��xeh�o~���?\��rw�i����rg���=�����3�8�zz��g����t��w�a9����]���o�ֿ�'�r��[email protected]�#&% p�r�( 3�$�l2�$�l2���$#v),�<ҿ������g�k�̟65����o�y�ܖս �f�z�q��� ˚z�5�y�ܲl�|$�h��|s#��yk[��i�ٜ�k[nz�lhb,� � x�q����x�q�ƹ/4�}i�̀ճnz5�ies���e-.-<׌x�ܰx��go���'����?k�ei�/i���9�>}s�onm�ln�����z�64-�ٸ���n�Ԫ�?^5���so_;�3�κ���7��ѳ��bj�<��,�����튾 ������}�߹�?�v��m��l^us��o6-����ڰ��ᥦ�w�g����|k���$^2���e�&��͸�n����o��ێz�&&] (�bg�!h���j��hv�a (4 ~�="��� u� )�r�a쇱�ۣ�'�������e�\�|�?��gn�n�-�/�醟ϙ ���i�s`�g�]�8gys�����3 �2u�p~�jeڵ�e��w66�|c�k�[^���⬦u ��u�`4�z��ƕ3��;3����|�g�?ʬ��0פ����������|�ӯ{����n\1g�sx�y� ����e-�`|0e��i�ӽ�i��g��=���������ժ|�����ቁ�kw�|��ϸ޵���uw��{};`^6�� �uލ����n���� ��_o�s}�����v�wo^p�m���h�թ`cgۆ�ֵw���֝?���� �ȕ"%�����,t�xd�a�flu��/6�������޵wwnn]���uc�m���юo��މ�@lh�kc��໮�h�;��y6}��x����΅�v��*&�t ַ��t��絅�� �'��v�y��/xpͷ�ǡw>p~�<��� wo�vue�ۃlw/=�|����� ��or#���px �h�f���٭r��t r �� !���a jg��*v*�k_��z)�k��bx�uy� *j�|g���v�a9� ������������xk۷�n{g�l3�_�b�ڻ-ڳ%��gg�so��@����aoo�����f��#޿;�߫n����p8��z�,o d���ި{kէ�"��{$�%�� ���t�فm����ok�&�]��v�@�ndؽ#ڽ3ڽk��ȣ�?ht��c�ۚ�:��p��se�h�=���ət��hg\y�c*yj^���<�g,��fq�uq�*wr�3�(<�qh]x(�h#��s���ꬵ�{�}�) 0�u7�ٻw��_�����02#��r t��n��ʧv� ��^kj�c~p ���#�i�!ɸ���!���<��r����j�� ��|�r��0�ޗg����ɏ������sx�e;�h��48b"���w����,[�lٲe˖-[�2�\j���1k!�6�(��e�m��ط�z��e ��)��^)�d��‹��^��,�¢t#d?%��uu���av(�,��:�bu�m k_:��%��������hbede���o hih�q���i�� q]a�������ỉ�a�:�� d��•h���o:���n�;� �^�}a������� ,��{[:�%�f);�ic=���vx�ׁs� �� ��$dfr��pm���~z�pq���k�za�$�[k��*��:��o����7��6�qf�m�� ��/�>�1�m�z4����<�3;!�,av�l��� l� ^�i:o�bo �,�[�����c����;���%�u ��8:qvg(�-/:����e;"�� aiܰ�=!�]�fk�g,�i�eኂ�}��[email protected]�<�lӄ���e'��an��� ␇����lt  [�;͍��9�#(c�h�����yњ�d)��иm�ٲe˖-[�lٲ��9�hh��� 9�2l�5�s"��(t!�hr0��c��@�,�3w��ƭ�as��1b 0a2k(}�x���a����c�f��r��טcnn�e]�t���]����k�j��-��� o���r��k���.,�ev`�^�!�oz��>����c *����d"��ghq��~�lr�'h ԗ�/y�q}�&� r��_�֊�#r�i��{y'��oǟ�a.�'%sz��:����yx¤/�nt�fo��i�lo�>�?�q�!���^�}}�i�`��� m#-�"jz{�l1q��� �i��2���9�l�z��r'�7���8��m�ti�g(��c��ϸ9�([�lٲe˖-[�7ʄ�$t3r�y��(qȁ���䰥��l�~��nc���pb|h� �u��w��-��v� �ۚ�^�;�\�ā���c��b۹��� xz,!�?v� vq�pl�َ�bq����aj%�s����l/hofmoҁ��߶�n��f�vǖ%��ՠ��'ub�,��x�z���4�� :wǜؕ3�u��1����엃_��e\� �do����& ��9_ �i�`�Ԥv��!�$f�k���/0��c����c�]w���vm� ��k��>������k�4��k~{wo��h$�!'��e���[!����vrh1�=<"��4�p�t:!��tѽv��,���#��1e\` o����kz;f-s����1���\�c:s [�lٲe˖-� [��#��qr/�p-g��:�jb������� 8n�x��i� ��$��f�c#�0���w�fw�z���c�te_:�q�ab��qiz�c2 �sp ���k� g���-�9�qfv6��(�k'�aq2��`8��a�hsg�)?���x,%z���<�� g�b�� �k`�j�>��ղ!�(dy�ºm��n8(�ئn�'���!��늗-���),��*o$��v~j�9,�����x逰c�����ʻ���%/�s>2��7f�ޠ��ҍ����q�$䗼� �xi�g���wu���xs�v��x�xg��wj8���`�ta�ѳ�jwqeχd��8����*d5 έ��܋nml�����5v��yaduwab�aî3��'�e�lٲe˖-[�l/d�l��� 9hx� �[email protected]�yy��;�ѻ ��ryn��~pkd�z��z{|2��vvh4(ki�q� �(d��kn_<��c�p�sa��x;(7������6��zb�ƛ��єh��ޞ� 4ygxu���!l��ldi��c`d� ��w��&��x)�ha���o�)��rt�-����!�rэ���z{ưwos�r�� ��h��eg�x)�^`��s����&��>�4�$þj��c5] ;#x �������.�i���z�o��΃_jw賊gqo'g�>g{�it�z{�lٲe˖-[��>���nj�j�ܭ��ۓ�^�����vmsw[��:i?����������sl�ѣ�ǜun*[jnc�1r�ܭӷ� z{ � �m�)r,��jf�����vȱ �}z��'����۽$ڒldj�f���)3 ,�~��25�^ u�v��mۛ� �u���7��plb�g�o��u��2ib��e�|���e��mpb��l���ޞ����q�l��d�}'�]e��v���h�=�m�ir��v���d�=[�lٲe˖-�k�8mŀ�ur��]i�;�\#ϑ���� �$;y��x,�2� w6-�j��ɕn��s�e�[email protected]\���2�v;9}x�y� ���!k�n�q =�#‡%)��{��øo�m`��r�ۡe ٠��i��tkn�f��%/gb���y4����ϻ�if�����/�ʼn>�;�4��쎇�j��w��{){�j��79ɖb�lٲe˖-[�l/f!��rn$b���)i�f�b� |�3\�bcc�:�q��&��a���xwo&0)ai�/��.r�qp�v�k���?���0�f��v<�:da���^f�,8krz/()��t`&3��3�i�w^1��@��c̺�2����� w �<� �qfq�ޞ��s�y�h���|с����[�oh$��"��|e�� /|��nn��h��ι��,���vy���*%^�� ��q��m��s��ޞ�ˌ��u׳lw�v�zҏ��;����.vy�����8���� і�`�8a�!�� �_a;��skrk��vs˺(��k�k�����- ���9����jl� f�j)����>��ǰ���*f˖-[�lٲe��ƹ!,���̮c;e�d����m7?'�t ݄i6!38��kѵ b~�p��}��oz[�36!lf�!�a��@>�zëϼ�"-��ei�md o;7���*ta%���` �s���p_܈��9t�ei�js]�h���z_�υbj��}�b�� �ehv�%��[���[�o�t�'�oi_���d.*�>ҿ �s� ՝�&ڎ�v�<��x-iq2���8giy�t*��epɚ�����|]���x�r:)y�mڪ�{��z�b��{���e�n&��ÿ́��_���ۻ ״2�jw-�axġ��vz�a&��rzv�λ������]i�ur��{6�@�� �=���۱ͣ�ٯ��v8zzu���z-�dxɱp �7%�c��վgj�s�g7�= ĝؑ���\'���x��b�����1x�t�{�*�=�th��k�ol�lٲe˖-[�l�^�8� qmjig�����îz;$t��!�����8v� b{`cj����&ɚ24) �w^��0�����nte �ubi�j�:^p*'�q��u��b�o})�i,u���0p�o�m��k�<]c�b)��ze-i�cls���\֐\�,��\v��|,��v�8��a��������b�o�9;�d��r�b�vƿ6��u�uhkғ��h�d��ʤ�k�4�:!_���hِ�)yg�[�q��s�e��^���������v���qb*9a�@�>�����i����7hm��]~z��ao���4$�p����c^���d��4d�a��1{$ �ay��3ie��a;zw�{� ���|(��@��gq��b�*y(���4�j��s��[���lٲe˖-[�l/d��c;�zpd�ko�f��&]v%��*����p�z�,% i/����@�ň b��t�v™0� k�ku�f, m|��)���r�wz�(]am �0�h�� �y��(w�g:��%g�  c�[m�f�ۓ�w)y�ai�*%n�,˸���� #��g��ѭvށ1��3fp�ya�m_��f។�i�?} [[p�����q�.���,k q�4f끴 �y讋���=�λ:��)�����f�����ػ�x)��7��57kl��������°�kay�kgk�t�h6��)g9쇨tz*l���i���x���t(�w���[email protected]߆�pc�k�����0����.��k6�����_�;�\���ίp����ٲe˖-[�l�^�he4;��x��ͽ&�]����ƴ� }��t �´(�� rݭ��w9���uo�����>}���� �u�ggzt(���m�i�b���)�•o}��c �7q�zns������yō�o��v�v������5�u��<�ӟ��/�]_j���y�����k��q�:�oq?��h��%tli�*|�l;-�}��j�_���*k��m��t�*wo�t�����z����v�����5�'�~����@���s���w�}o��c�m��wz�p~�3�=x?m�_p�u�0�$i�xc�k]s�����t������ϧ�sb� �-�ޞ-[�lٲe˖� �6d��$t���w��cr�3�v%wi�rʁ��m:dy��w��p>'�(�t&�x��<���|�`���b>�oyxb�q��i��y��f('�^v�2�ƈk� �(�_e�rd��z!;�6\�z�6�tm �j���g�y��7dra#^r,)m -�--�u����q��x*{)���9kb�i�13�h��7գf��������"�k���kǟ���d�ir��y�ӡ�5�v��.����i��ᕲ� ����@�rjrm�nw��otv; ߺׅ���޴�j6�#�g��csw�qa�[email protected]�`xv�?�(�:��-��x�s.w����yȫb\��[email protected]ǣ�qf\/eby��e��;��í�3��(��[email protected]��~��z�v���?�o�� b��u!�ʒϗ�jr��|��pׅ�$�t�gk�xs`d4�iħҁph3d���s��������&��p5�5y^ ���k:s]"��~b^�f�a��[��r��sb����f)oh���z)�q���lљ-�����m�y��h7�}�k_a���ꖾ�3�� |6 c��˱���i�wc�����إ��?���n�`[��ѵ_&�w7�y4[f�-b^ꢔ���v]���wk�u- �(o��`����z��nqc�7����u#o���̈p~9["o� |�b^-��bm��r)���� 1�b�(z]d�m<��[email protected]�~� )n�;w���#�� ���w��x�5�6b�a r�>�xo����=a�����}����?��2� wm.�moܹb�p֋����9�����^c|���7��grj���|��4��*�yq�i9�t�<�� ney��ˊ�ωb���x��b|��y��rn��q��5��04�k��r�h�-��fكܲ��q�'z;�n{l� �g�u���e<ސhv۔�b��3����^����ѷ�oy_��� �pfi� ��0[�lٲe˖-�k4cz}'l59ͣo~���v�*���4n�o�8x�{bmrm�/?������ƛ�>>������������@��m6�0�67^� g�{��;�������m�= a= �լ����~�um֪z�킄3mb:�w�ݞ��������m��{���ǭ �z;n*��ӆ`�`� ��'�ɽ�}p����k�7�#6�>�b�%<<�|��o|���gﮟy�~����7�[email protected]ʺ��w��g?[��⽳w�][;����_�����{ ]��d �����l�כ����/�t�?j>|ob �kobcpwz��w������l�yzɶ��}d�{͟�޺�g���}=�:yc���7oׂ�]{��v�\��=}}�1}7��)�w\�s)|ח���.z�[��������^�s��!���ݼ�x���}x���3w�o���z��7�c˾���9��3k�����'��r�o?ej���_�����[��� ���x k#�����x�f:m�����k�h��?����d �l�my����w�|��s���_l�ڏ�������3�i�]o�e1���1f)��ܨ�s*|�۳e˖-[�lٲ�����!�}��%����z�{a:��g�0�}����_�=j�����o��oo��{��� ��/�ָt�"��kӗ_�t����ӈ '.6���c^ ��.\b\�j0.�on#���2>�7.�m^���cs , �z�1~�1>�_�'�όmu�ˤ�q����������w�d�x_us�a�x�{�'c|��4�� '&�np����� �us'�'&������ �*�6��������]������_]�o�*蒤�[������_�w��������w.�����w�]l&~i�o\����2�΅�鉱k�ǯn��8~�q�qa���� �om!��^© ο����xq�q��)�����'ϟ�8����s������]�`p����x��.�mm�sɂl� s�.0�.�ǒq�ssc����9�oa4ܞ�l�%��¶^��l� � ���h�$��_�^��d��}�8���>[����i&��ml�s�.qg�n�����*p�����=smj��e�58 r'�'��!&on������߹|��h�k����_|������ć�x�,`�\v�:�����z�����s���s'�o�_��99v�delj�癢��������~�x��a�� �ߺu�_� fz����\]yog(�єq������f˖-[�lٲe{q��r��v�~{)�ďz{��zo ‚�b܀��� x�������x�c�a8����ho�'�l��k����x�j��0��czi7�_=�o�.x�[~���>�s��g n���0� hu�w{=�7ru�i�n/ k[��-}�p��fp��n�j �w��3�߰�����m�v�48���f���惟&d1韃���l�}u�4#��}3�g���ou�"<"�ٛ��n�6��$�z_���?݀-�|9���~>�3跆|k�@��k�p�z��^�c궙�? ���կ�@� �e.\����d~�j�af����x |h��xw1������b�a����1�np���oֵ�t� ���f��-o� ?�|���i�z�˯��7�ҋu�e�������g9�k��{��`���?�����&��s�!��[t���l ^�|��ѹ�� �sk� �g��o��/�τ^'�[��g�#ek�@p�� u��nq���;�#�ʊ��w e5 c �� ��jla�b.����i�� vk�� ;�'0�e���pgk5�]�u�?~�/�� �[email protected]�\�u���6c�y3{sȯfm_�4�k]ˬo�l�sv=��/�� . �n��o6�?����:�,���k��/���>�_g�qnx�w�n�g�<π!�`_/���ݐa��; ���=_��b�:܆w��p醍×�����g���q ##�փh���{���lٲe˖-[�lⱦdo������$����w0,��m�_2`p1³0�6n�2�@�gʈn�u�s������vc� v�é�� �v���að :�ɲɠc% ���s��|�`�l����*�k*�4�� �@��wj��<$;ߒ��h�,�`��l[s)� �m���l�ݩ�n����� �� p�"����i��{:|����f��c�xek*�p��7�ac�����m���w��[b�"��������)��#��f\|3��y�$��;�� �^�-i\"t�r l(��r�br#��rz *3t�᧼n%{��#/:7��c&eޒ3*�p�w̡�� ��g�!��nk���70;�������ޙi2yi !a0�d� �m¾h[email protected]�w����[email protected]�@@[email protected]�%����� �>�]{��ھ��{g&!a��1ʘ�?��ͤowu��s]�sj_e�����b���`�a���n;��z����v ��l� �.���ӻ�������9t�^_t�&ol�g�^��x�l<1�q�����u؎$g”�% & ���np?$t}�ji�l���j�3��e���5�f�u��*�ss��b xjl��� pz�j�\t���(�-�'�dzarge�b�ڔc����lk��e��sj����&� �n�g��3��ja�y�i�9�j!�_��̈�9v�5r77$� �e��h�no��3�#����[-���μ]��_y�|�l�&q��r�%ow=���%�v�ƙ�nno2 |t�p��^��y���ү�b���v ��$��r��gʪ� ր��� 3#=":��kwaz�xl��<��t�u���bꞧ�u찁о?��ј��4 ��g����������t/"�ۭyko0�/����)4l��ln��1���3� � __��txd�(��� �v͗}^����b���r��oxg?p���l�[�h�x��ĩ�ȯ���d����(���ѯr� �vjӯ� p~��jay����������n�.�� �y{�p��ƺ�w������#�����=5��)~ i�o �v冷�6���eӄ����c�ۅ.��� mk�b,����3oo4r���|����q i��.�2��n5ix�d?f����vax{��ۃ%!���nya� q�m��k) btme�w�o�� ro͈��ҙt]z��f�ƶ�ۃr����=� o�>j�ۭy��y��2��me;1�c�v�=qu��g'a� ���b1w��ht�vn0�[����;�����̦�~m���j��������y�n͚��vvvvvvvvvv[���vt�� q^Šy��)�ӫ] �4��@okg�r,�zecj�����5/u����iz����������d'5(�?cwy�47���q����b\-��?�<"n��2<^k�j��k w �t��!�2i����[email protected][email protected]�: �l�`��p�zu�gw��g�va�g�>ޞ5ϝh�wf�(ҟʽ5f�3} ���\1�sr3����� s_y��$��'�*�scu�z�,u�cꖨs��r��*gb����s��s��0�s\�_ �� y��2u���!�,tg�#*;�l�j��pz��q���8i쨳���tn?q̃lr�#�l:4"�y�4u�̧���n�vq�jz��k=ԗ�q�$8�� �jūת�jp�ѝ�a�w����x;��ݚ�nцs�)t�ѵ�w��b��gl� b#jס�1u�iұnsd�~q)qzb���c�bxr��bb�i��!�x�up����:���_�a�vb�����g�f�t�rǩ8c�'r!�w��m�j*n0���n%���u&p�h`��v�ۭ��������vu!�^��m��μ���zlq�y5����i�7�g�w����m�pw�ny\g;�mb��vkg�n]�)�p�quq'���z�'8��۫��u�bj��۩�i'0����_�@�v �i�!����c-�2���s���w�yt�!�n��x��6�|̞������ �l3a� ��?0� ��x�@�is�������z�� f���~�3�p \�m]����ؐ��e��/����h��td�w��)��~ht�;h-4ȋ�f���tk� c�ӽr�~(a��b6��ft�s����[y�r�ȍ/��8�̪���*ooj��dw��8������0�/>o���֬m=��մ��ːr�\d�l��� qƣb�g*`j�ͷ�;�v�b��,/�&����l��������iz�s��%�t ��$¢���9<�,�4pc?s�s��g��g��t��j{߶��ubq�{r ��ݚ�햷[yyyyyyyy��b�� q�t���oo���h�צ��4o'xfne[���a��0�y�����o�z�m^t�����}]�9�we�h�a�|u����ly���"����o���v��w�,�)o�]^r���ۿ��[=q�}��~$���%,jp�����e�k�m��v=劣myn�q�3�9��(v �w���jl�yh*ϩ� c\�j��y‚���#�<��s�j5������5o�[�` qy��ji�i{9�cd9y������x;-�%�lr��hw� z�쳼]�xq)�3q�j�ζ���wuf o'��[�)�\�@�e�,o�fm�n *reh�:?�p�,qa��5r/�!�@vvd� [=���2�jg�m��d�x[2��y��4��̔�b' ^�d�4�i�� ��gm:��{*v�x{-��p���-ԕ mź��!��_rޮ&�zv��vk�,o����������ڦ����z-� z[j�з0��`b�'1�3ԙ֊��x�v�\[�m�2��a�3e &\�oqc��"�v� ��t� �wc:��'p0$�q$h&3�� ]�k a` ��(� n"̔�6���շa"2�p����mps�*j�_�d�x�����)-7w�ƫ�?�\�wc�|l-!���t�ee����;p�r�����n����p;�`p�ΐ�obq�8a��ʈ�jp�3�1�! `\���dy�j��]7�%@��ە����c�x�� ͦ i�h{�t# � �1�庂��ƶ�#ho�p �w�������c�/gx�y�d�ӝ#�8j�(�obb˧��f�&/�uqi�w�(� �to���'�΁4{u�=qw�t�ʀ��t*��"�vby�5k[rhau�� pd9�5i�y�t�!i�x ˂# �,��z���.p�$��66�l���@� w��&�&�i�n�9 �l�@�b~z ��jzs8��dx��5c0k����8i�$�� �q�1ei;�s'�pc=�� ő^��{�lyqc ywyd�ox;'��;o熓�v�ށ^y�eu��𚅷�c_���7���&>��;�nʤ{ :j�ke��?��c�)� d ��������u�%���e}i� 0e��m�p��p���fpv�. '^%�`��� �=ĩs_�3s�]��p]�^n�;-�&n�"�䤘�d!�e���lq �4�̜"sk���ѡo �8��vkֺ c� ƙiz\� ejl t�q�2����".ݶb��-���[=�ō�.k���r{ѓ� &fs��a�����a�3�e��e��i�0s�n�&�%� !���� �>�e�}��@!!0tq�w������t�ts?�{��4!�g �z��(�� 1��y`6x����v ��i]��s�r3�o-c ��v�"om���c/.����w.s�{̜ ޝ���`���d������$8}�5 l����f�)3����൩�����w���[email protected]�� ޝ,�p�zu�2l��oo��o�g��������ǜ�z�5k���6�v?��� ���'��f��m��^y��a�)� w�t��3m~�� �kv8 �����'�ܶ��'`z�;��}�v��ee��i n0��6в.\��2?>�{b���d��[��7��&������`�40y*��.����(�nmc��f��cvr\��@�a���8��k�o�-[�,~̟�.�>���h ���q'�2��đ���u`�b8{6�<� m� ���~�q��bc��@���8v8q�� ں�|�s�†�3�i�䷵ϟ�>\�ڜ�d��v�ۺ� z��� gt "� ����[��n�&��'�7f�i�њ��`cv=i3~h.ǚ�0�q��r��t&��n�x0{�1�]�]�z�>� 3' �b ���)�fi]��~���sѫ��i�x� .� �9�bǐ5l�c�f�q��|h*e�uz�ۭy��n�\oj��y3�@�q �t��ƶ`�b=m�<=;�6 ���>��ip�4<~2��6��~�ug�{���(�$qs�he-&y�ܣuc�� �%���yp�$8s�>μ����8 ��x�i�uu뛝� t񜨠j9rʼn@��e�iy�y��}o�3u9x�w�z!�lz_'�� bxg mhw�z�ǐ��#%p�k��ݚ5�ۭ��������vzuޞrpm����w�(g�����k�{a�{��1}�s���#2�nɝxjf�p��7�����1ü��ύ:#w��ޙe�=q4��h��q�>g���� p: �p�3�t�w�pߛ���esc~i���������}0��kx����:w������s�4�n���ݦ~�y�w�'����%�d.9ͻ��^o�f���*����6�tcd��6�zm�>9`�u ����4��3oԭ��5��8od�o����) q^ x1[ �q� � q}[��r.��,��n|����ɰ�qh���y_uf������#���=��̷��|�������w���as�'��>ѻ>l�t��py�˘d6�����aw�~�1��]| }h�cz�<�ae� �����%n���|z7wz��ǜ��^xy椳2�� ?]:���?�c�ԁͥ:]�i��x'�x���?���k/��s�sو�s��]]��z��p�kx�w�ȗaцgj(���a���u<�v��2�;.w�!��g����۞u��oj��g�>0�u�ʽ����=��� ��j���'z��:����vy��3� ���i��q}�m�����k}}�����w��'���5uk��0g3�k���ȑ��w7�n�t�%�k����ۉ��֬i�o�ĉ'�,'n�v�5�\ �6�r����ӹ�lg�ý��h�w�����t�ɏ��w�5�� �k�ɞy�{�x�� /�y��r�^�l��&��es�x��=n�����㜋��\xa��� /�f�qo���ߵ��w ��ݻ���g  c�"�d�h��d)�l����g5��mw�-��y�z�������rg$��g:��*@����#����gii<�w�u�ʭy�yy��my����������n�����-�o/���^񜽦�v�k���կ�co�>r�.��=�3��8u�������� t/8d�kor�ec.=�����zl�������g��>�o�a8;�� ��=nj��䣽�.l��v����/k|sz�;�~� ��8=�a� [email protected]�q'�}�~����z��z��������5��_zq��#w�rx� �5>ps�l�!tx��o���z��؋}λ��#2�����˻�^��\�,ҕ�] �u��vc��y{�w��a uzx} 鶡9�|^v����i�o_ԭ����sp� �|��!�3�� �dġ�����#���r\����󍻭xb`~uc,=!��䰬�!�o>��䋻\��^�<9����i��=��^�4��*��cz�� �e����=���w����]�ۈ�{��7>{������� }ִd��4$�._;���������ɞzn�1#�r�?�ˏn�u�m=.�5�����@�!�-c�h�gx�r<�)��-}5���cnܿ��_r��m�ѭ��(y������r�������˝s�{���c��{�f�{ܡ�.=��m?��⪺�p$e2�,�an���isz������fg�s�>��n���g��h/����$�j������ ��,�u7i�k�/6o���֬i� �0 3�dx�t"�)ήg�냆��s _ox���w��g���`wx� 8rp�e��a�_3��������^����zwl��� �s�f�- <�u�ti[���z����67�����]v����^1j��������?>o������{��g���� %q���v���) >�f��� �6�7�w�n2^�w�wp�ps�(ֿjp�ۛ��`1¤�ʼ _8�o��$`����vk����v ��n]����j���[��bvl�a���j��q/���h�����yo [��#����?��ic�} 8��=~ˡ�_8vޤ�ϝ��7���c�~r�s�غ ���{�s�uwx�yu �8���뇾��>]�夹�\��:�o뵢�۔���@� �k��p����n��������v_���^v���p������r��ɇl}|�3w��u��/��s�|s��yi0s�እ�w�����]p�0��%#�s�b��h����og�s3`28(t�@)����l����ܰf�ns���co�q��n{� �8ǽ��=_}���_>�7���w���o<�������qι���߀�=�t���;his6)7ʠ�r�<�oથ���u?�#f�c��#����>o�ָ��% e�$�%�7��߁/���8�׫swm�a/�?�'�|t\���������.*6axi�ik��6��~n;�ya����w���_�⳯�>�8 d�\ٜ��h]3\�>x�w„!���k�x�}�^�q>=��ц�4�a�pl��ޢ%�~������g<����/o:�c�<:�w���4��q�χќ���m�<�&h���e%��|�qt� �߂g��st�;����� ���۷��a���%n5�by�5k]�լ;�w���tb�h3y�k�r-�\�^�����'=v��'�����^�����m��s��d��� �=��w~��#?��{��_�{���գ��n��̬i詛��s�׸�����m�w���m�a�'0�/{��p���z7��f~]�0���p������b�db^>^ _���%��>p�k��o�>ti>��ara&���r�y{��s�^re�ձ�6�� e�b�ۭy�ny����������n�.��yjpjl�ëe/r�� k?#��tm����^|��4~xzϲ �|�w~�wf�?ྗ_pw������6���c��:��v�����h���s���4z�a��g�r�������g�n�����[��>3��nð����.0kr�gs/��z�� ?��ږm��.��;κ�,y�w��}7����yc~���u��[��oܔ��f���u�$s��mk��/y�쎾_�l��}>\;���ͼ[email protected]�m��:m�͉�"�r���5��(�5�� �$a���$a2(q� i�d��� �²����&v���{�p���yy���s��gwv�{z��_]�z�i��v��1u� ���v����׸uli�� ^̦6�g�b�`��ӽ^�1 �@��� ��(��/h���h��� ^��.���n�.��ݴi�[qxf����_b� � �ob<�����gk��lz. n���yɩ�֖�_�w^ݠ����'��x� x��ϣ�en��a����s�����h���=��#3�nu�wzָ��qan�#a��f��{��ր�y���"uz�a�vϡ����p���ohao��& ���m0p:���_��^;�w�������pq!��ui�w�$}�a�|����di{��dj{�j��rގsm�nʔ)s�l�2e�o�{��߶���6�hy���ڌ�u/�.�s �se�rc ;�k�g�q��j>�ko]|��r"p��j~� ��2��\ۅ�دo�$�g���(mq�?�>�8�mb{�p��mew׫-ه������2��'����1�lo �c3`��!] �l%v�uw�j8�}0�5���m*6q�]���k�b��00:q���y��9usxz��w)�ܙ����vuh.���v��a�2��~���;�t�@�@�ϫ�b�5�qߟl�h���o���`�7����خs�_�*� �� �q�:[email protected]'�1=ñ�5a�k$�8�vel)�.*=l� �4ㆽ�^��~��z�v($l��^�������� t�p�b���:�����wf�>�z�?�̦~���>xr�ъ�ao��l�{2�r�ij$g�� }uq�/{�����o9hn���pt6�t}�]��b�˜"�5�[0�z�*�������{������w��v�8f?�0�p�x����%���3]?[p�ެ�������er�rb�$�aؾ|�5�%��ϝ��u�p��� #��͒��^�ˊ۽���|�iӡz�1-�[email protected]^y�z-e�g$��wʫ���k4~s����c��/,u�ci�[_ 5v�����˹�t6�} ynp���d4ݶ�y����=x��7�q��.�!�rb���l|� s3��m�a�|�;o�3j�kh�;�6���x��[�9�~i��w<��/o��m����u���%}v ��u�[email protected]��xd�fb�����m����`��ʽ3v�6}�x��o7eʔ)s�l�2�'ӽ�ۃ� r�"0�u�a� i�ouױ���~k�d��֧��˵�sr]�����:n-j��n k� ��b >�\`�9�� �g&-�ڍc���e�|z�n�ќ�h��~�\�-��v����92$e���~�����;��ī0��q\rc�- �� �m3^��x�֞�� ���<� �\a�<� 7 �z[z����)<���)"��t��g��1$m,��h5�~��.�ſp�п�u��"f��kl&�~s��o�u�a��bc!l0 ��켸ϗ4~�_8� e�������]�$"c��*�)%�e�\��އӛ[g&�찟�� �[email protected]�0% �)sk�|.x`!�, є�)���>u���1�q�cf�ǖ� i6zv#��}�����-9�־z��b�<��a�ɗ�iy�y���)>�j�ċ� ��d\��-�*:t�"�r �dd���^g���g�}�{��gu ԅ�pc8���'��'l٢��\��v�|��= ~�z�j�����_s12�y��x.��xf�d��x��r� �k����j���o�v���g�&o7m�.�vs��2�s�v�`,�qژ��/����%ou����.�v�#��h ��d^asox.9�oj4cnڔ�����o���۰��j�c=ԉd���9�tj *������ip�o`c�~�ug���8v�kr��c��,������������= |qb��f ލ��剏`�s���e�`\�*�ڞ�2ղ8��(ɋ���ҵ�{8��тz�~bcxe�c$�d�z��1�hщt��7���wb̔�q�՜�pd���$�^ʷc`���a hu�o$�io$� �n$6�0f����y_ zo�;v:k�ǔ��0d�:��ȏ��j��}�ё c_��x ��ĭ�u(�[n��"ӷsn�����gl�#��p]"���a� �b����v��bj)�o�a���~�r�/�e �c0�_����żzobz�}� 48��$�ff�,����r�f��ɨ��2<�� �g��eو\�h�[���� �v�{�%��$vvv#'z_�k�v������֣s*o>@�by����~����ڿؼ���e�����k�p3g�i�qszd�^/��ӣu��r��m#��j�m6��,=�%ǵ���:o7� u��u#e��feoh���ű�o7m�r(g.�@�$h���aw��^�v('|�zۋ�a��p�����z2��>pvw!����p�6t� �4�t�^n�` �q��y�~� ��8�α�pr�$"%ꌝ�l�l)��%��[��_n��t�w�crs��k� � � }��찭�١�����dm���#g|@�z���z�� o^��ku���qz��ʂ,0���^ ]�o7����!�,"��c�%�6y���m�2eʔ)s�l��t�v�@m��s� "�g$��[email protected]��pt�geղf�'��$f�!q �g\���sλ�[ ��&���x~]v#�[� �z�]"�9<�:����� ��}�?��ǥ<�q�sg��x�c'n5;��h���w/�5��3�}�.���g>��΁�ݬ�g������h�1��u.�od�e�q �� �g����ag�}`mdq�5hh��<�^%�\:�������i["nxi=xo���!ޮ5�ryvq,x�#��3�j��z�n� ,���cb�9�f�>��n�z��h�kp�v�@�r�j �=0�hd���u���er��c�o��"*%��20��x� &7����v��"�@��uctj8�b���,by;�b�^׍̄�#>�k����2�jy�(dtj��yh�8��a�$=ԃn9�:ni�ޣm s��veu�[z���hrm/�,��-�[�ag^m̩����5�qu�us�ə���|�����0 ��:b�t���.p��!ia�~�^���`�vu�a��rn�8�)8�y���� y�:#�.��۫жy`j j�ˎy ?3��־e�5 hr�����:#uf0����m��wb�z/���c}�\���a������[-�%�֝���1{�?����ţ�jm�zoԓe��e�ԏ���h^vxe��cg,e�?oi�5���)�h��her�oed�xʖ���̪����]��4-����?�ȅ}ͯ�j��ai���^�j��/�_?���x��.��܈mi��r�hգ���o=y�� ���5t dj�rr�e h���o�w yb z�0l�v�&o7y�)s�l�2eʔ�?�����t�������t�r �,%яmu%`�o�w!� ��l[�j�8l�ȗ���/;���1 p���q�g�� /� ^d�m�{�{���:�׽���?��р�6;���!�?��`bۘn�����o�iw�*���%`�s\�gb����8���n�^ն��qcˈ�\�_q�������=q�t�ž�� \�� ���,s'��s�b����h 7a �=��e�j=���7��_����#�a���*�g�2 �� ��ײ��b<:owtү���wc�i����̷�2eʔ)s�l������x1����풎�aà��(��� h u���d���"������1�v�u�z�uزj?w��w�#���!��-��=l%^b;s��n[��m�u�ol�~wy��t�rt(�]� e=��@v��e$kqq��6�9��2��v�pz�ǒj��b��ye� �b尌@��\��e0�%�^<�� ak��]ɷ�� ��j��>��v�)�zf&:����r� o*@�)qaju�js{�{�k�n �z�z����m��qg>�j��e李>����l0�#�� ��3�փ�uk�ng��(�g�:�^��՜�tu�#xe��vt�����蛕`\ x� h�*x��p���7qy�ý��bx���;��a���n_{��y鏝��xg�k�qf�$0� �� ��3� s��j�<]�-�ع�ز�3j��ԁ6� ��*�����!6�j�.�]����������ݴ�����h� �x @�gd�#�%�w� ir���0�۰�`���n������o7r���v�s���l��[email protected]�^'�t9�� m���kt�1:�ح#kh ���d������ӻѫ�֮�m� �� ��h9��~��q�py>��v�yn��) [y�o;�9t���5 �v p?������`_>���g?�y ˴v�����d���j���j�d�vӧm�nʔ)s�l�2e���y�op(vv%�����g��/�=价��n� *1�tap��`����dk�cy����ٷj��k�zv�3�3q.x�}0-ё>�!���h �v`��u; :��]\����������ea��f���j�aa*,�啨���]����1���ek��(�%��e��b��l��iz�s��)�r�j�b��'�;� ���l�ay|v�%h\�b$� ���w�)m�^o��5�d�v�����z�ru�7 :ڃ{u��"�q��@�qp�ϊ��c�� ��(�o������a���v�a�)h�7noz�v�bxc��vjv�2�z��\����z����a뗹��3���p� u��g��$8�qvxg��]�k��v!6<��p%�@y*�di w�� �f�� �ր��lk��q-z� -���$���� ����#_ҳ�����o7�t��n�^sg��� g�"��#m:l�� q|z*� y��}t��t���c38��ec.dd{ �}&�-xb 5d4��.�ѷ,������%�n9������[����g���ܧ�t��u�ju���5�� �����ԡ6���\?�䪍����zr�0��固����]�����ь�hx��.e�|�rcٿ��!�.��ݴi�ъ̊"�"o���(yt��s�f�]�ӳ�x��d�n x�)��6�s:*�ⱦ��y� g����["��o�����y0ma�����4:�pz��~�df;������\��~�]q�t���әԍ�����@x>a�kіu`�[֤w6����y~����7_6���m��n�=���4��2�ci-�k��`�%*�������� a�*ҭ/�j���m��5o�&o7eʔ)s�l�2����x;q�kޮ�sp;�� o��o�� �e4x�ϻ��>�ud�e$ � "i m~)aueyb�r��흝�3��o6!a�@�ge^ �<��vryz-f�^w�"�] l�ŝ��_�g$ ��|��e��z����w����ng��{3��˟g)-�3&��˰w���u�ju�n� з#����q�c�,�;_���w.��pww8�{���>�v"��~���cx����(bsu���j��r����= ��k�*bū�|{ii�� ��w�z�v�s֥ǐ'����cz�����9�^s�-`�x��v�;��*�a���^&��{���.p��ю�e��$�f6�fca20����֫%tz*<� ��o-�(� x�vk}�x�#"9�.���hޔ��^��*"*�!`"��/d/f�yɢ?m���np%t%q祈��7vx7gb$�9�5�g���" �'k��u]�i0kstۡ�_����t�����jt�9�{��v�7��o0�|�����ҭ0la�jl�h?-�^�o�b�|�����|����*��:o�`�n!4u�n��wj�c�������[/e�9�_��u����vӧ��d� ����x&������)5�?�tf�ov��}�����g �1�e(�@�9� /*�^��;� ��80�s:umt�\�1��ru=�s��z���^��m��#q���>̔�� ������]c&dl;c-(��r�"��j� ��h8�1���b���ͭ�$�2e=���̀;�ém��;����>�c��ѽ��|� �0��y��� z����[kk�v���-ǁ�sவ�ڴhr�p�'(�� =a�yq�(��q��e2l� ��̞�1����zv���s<�����`ģ���—�qf�y{h��n�% p�"r��քry��#��p�y[un�p��z��gf�d�ˣ��[email protected]�������^��lzp��c�&�i�lg5����?쪮q�v�_��s�lq��_6aq�{tsէ�}���cn�����a� n>��9ݫ ��)��c(��s���v.i>�qѓٔ�&je�π��!ҥ�%mq��k�:���jh{ה��ߴ�=`��n�m����v�jh�)yк�o��3�\�\w����f�ݴ�;��� �d h� �a�`ju�ȷ{�of4�u����k����ւ}1$?�#�2 :��#i���t�x#��e�ˬe�o����4h�5�;x����"y�ц[email protected]�> i]��c�lnh܃� &|eu�#9�j]�-��@:�:�h��~�z�-�) u@%�/��;̊"m�u���0y[email protected]tu�u �qq\el���.�*h�%�䜳���hfhð���μع���s����]�?��~~�}�wn����]��>̛o��e4eiç�);p�;-u���ju�[r�c���ӻ�z�ui�m��ݔ)s�l�2eʔ�[�(f7�)q �-�]҈h�l��[i;���}���u]�1.��zz�>�s�=�[m�;e � *�$j ��n�ȍ�2 afsl�u #ltgy��ɲ�ty���n�@��`���)w��6�>�>1׿yѡ�����έn�}��e��p0hs`vj�p:���dy;ԧf���-x������&�;���s��nsڲ�<��1��{s���g���]�g����� d  $��=yרuq��ck�<�2���])�5z\f�ve�~���r�}7iz��������z��cqe�*s��u�\�163l� ����:�r�\��=b�s ��kq9{:f��jf�� ~o�:��$-�t����e��>��~������uk� .�j�%vb�7b�z�<�&,lșo����)n�0ˎlk�ʆ('i�j_r����{�5���o�ԡ`�dv삄q����~>�~z�pu:����)s�y�����1p��?�{���c���"�z����v��l�����@c� ���۵('�c!̋��֢q(��%k��]�z^c���6(;��o�r ���hz�br�qk�����pqqxe� tyie����a�5q{2�|:/�/q�/��iּ�$��qly]����lq�����vl �����>��k �j,�|s������� c���x�f��b�n]o�tt%�9�l�����0����[ �$�2��2х6�s�s�h"��="sg�%��8��#.�w�� |1�q�p���nk�iت*h���b}�s�� ��л�|���5g��t���y���3��f�mail protected]��tl�4�&rj��b��@��s�� ��@ߞ��4��֘�f�4���z�ze�_�|� %�xp���e����>��7�v3lߞ6��>�s�!��2eʔ)s�l������2�j"g�*a%b�� ��p)s ��`(�{��ܘ��f��j���c�"���n����ʩ���wn��m���l9�8y<�h�,f���ѷ��tǥk�n���#��a쁩�����! �����w��qk�o��g�e�h'-��k�}����{\��(;�)l�%4)croڋ�� �?��ش��f�܅c���|��q��\���}h��9�o�x�s�q�������� )(�@s��n���n���[email protected]��pi���i���t��������g�����a'����l����e{��ھ�#�y��m��h��թ=�b��ଏ��(� z�6��fy��k\��ۯ���)xp�� 3y�e�eg��*:̯���vzn���uq��zz�]yi�"������x��~�y*݆���5d�wm�#�������p�04�q�?��en ؂5n��q��5ƨ/�@���n?]v�t���y��'cq��ǧr{���ݴ�뼝@>"��۫�s�h>rq�����g��k��h�� � ����� �y{ӿҵu�� ������9)��f^*x5����<��q�1�ώx��`�fxs�fo' ���:i(7lx����r 6�*o1g5on8����jئ?���m���%;ӱh����b�ul��" q�n������uy���m�n�vs�l�2eʔ)s�� �i�f���� �2�d"�dp���d���w�dj��� @�ַ*"��j}�!y71��z3���&p%p�lda��%k ��0"f5�d��̠|*uf �kj=�b�ڤ�cq�.��]����?p�v�h�<����4����hbfe��$v�<���k�8���]�he2��8j��tk��|~w��q�$8!q���'>�]���y���`y� w�6�b�b�?���qje���tp駑p�;���`�ɵ]��g����ǻ)߭m;z�uŭ�6\�'��9v��4����apum�m*�qخo���tk���$� ybh��~ ��y���ªѯ����ҡt�xdz8i�u�v=� $ ��`ksb8!�j�u���z������y�wv��5��r|���բ��������`� ����@��p�6� �%\q�z z�r�}'��;��| }�g�{=s��1�p�;�i�b ��h->�q��s�an�r���`h?�ۑ��gů\ί�v�� ��-�����!��˩�fm�f�c�5��c'm�u_8a������s�7ow?��`�93� �au� ����a� ��ki�e k��j����[ή�;ƀ%c���o�9 0_fa�b)�'��¾�@��<��z��#���?8��;s�%�6-b��q>p����t�����{�8��g`�v�g7��br��ʋ�j����h�([email protected]��re��7^����o�]��(a^ z �.q�����ekqv���~z�"���jq�f�<q۫���1tm��g�go�l@��2�.��x�b ��(*k�痿���r?��@0a� ��;� ����0�ǝd�f�kk�u���ź�;75;�ۡ'l�:x�}��hv�j��l�� )w��Ԥ�js¾����i�]�`�`0p5{�ן���,i�@���a�=����s�� k�'�0�b��p��|����m�����7��n=s���� g#�p�z#pu���r��e��*1�od�*ƒ3 l߶6n��� ~ ��fӆ9�2eʔ)s�l�2u(��ubc�0u5��d�4�a� ����v g^�c ��q�#�e�ȍ���d��1�?o�t�htie�j�x�o�9��s�\�}�.��?h�.o��w϶c��������ӡ]��/g���zv��t��6��^��ӎ�n;�j� _�ɷn ;vr���@κ�� �4�h2�kxp��q�k7oi��d�}������v�c���w%���q��7ƀw�©��¾���5�5�֫��5\��-�r��.�r������jz,��j���/߰t��������:�,�:�~��x�v  hŸ��q(� �`]��f(6߷��?~ q�� ,���!q,������`4n���y��$ju�蒡 ���\����4�љv ��ݵ���w�3��c�����6w�>r1�ց��l�o[�m��f_t�ڂ�߂l���s�(tϋ��q�w��@�p��i ֺ�z�}����5���#i�\-wr�.rg�)jy��a��vo�gmb�{��z;��/0�t��ۣ�o��c��|qf\޹��� cvr��� �m�7�'ҳ/��9���ᖇ�7[��w���/�����}��oy�'�4?�'��8l�w�k�˾_:��i���)���`�<��g~���0����8����-o�oܿ�y�̜��&/��3��b{u�j% ( �9%�)��h�|o��?��|�}����c��s�ɪ�e\�k}���ek(�p` �>y{]��z�g��2��e�u��.%�/�rn>w�b�����cc��nu79��4��izl��ݲ��@=��ƃ}�"��$�� �%�<�z��dž�k��k�������~\ܲ�p�ڊ����u"�jyb pm%��k�����y�͙ �];�]���3渦lk����g��>{����������y�?t���� �h%��t�����3*q|縮=s��m��r�te��,����x�ʞ �;�n�o��� 쳍��n�t`���)o��]��!�x?���$7�vx�[email protected]�fyoh c���m�����l�2eʔ)s�n]��r� �*% �2�*���j�]�x;�ŗ� ��ѐ���0©��:�}��؇l����o����2���?ŭ���b��= �������<�� \���k��;��nn>��]z1.p��s�� i�2�������)������j�d�[mm� �1�����ܵ�{�r�k�r�9ădբ�{���_w��/��e]k#ܨ]`�'�'ϗ]�x����u��=n� ω"�����15�����g4��}�'�jj�šϥ4u���{�l��c\�����ajo=o��ƀʀ����3��"�׭-��p�o�i!-$ dt��g��s�`�ñ6ir{�4�j� lpd�%,8�����~��s���qs:����a �4j�^&������/�4�ۧi�����ɲ�x�>�>�������iݾ5�|��a��5n��s�\�ߒ�_�ܶ�롖l�t��<�h�9:�����y�r�b��z���/���@�k� ��^��̏ӎ�qy���]�rom�~0�=�3��a��#��}w��/�����s{>�|�ek����"f1�ʝ����no��l��a g��i��͎w�>��w�ׯk=���r�x��9�\;�oz�ϛ �8���<���}�u�o`�@��ʗ���b��h��±�9�����ܣ� �'ő�&��!�e�\wo9d���9j��q ��(_����j""�*���q��r�j4}az��a�s�@�p�@����ά�/�([[nk�`& ��al��&$��� ���`��6]���gt�o �`��pej*-g��oj���;n��t'ji�}���ki��4�i��d�/�zm��0adt�4��c|��rۖ����g��������ҹw��h��';����~����m��o�{���|]��is���$�l����2ni|n�k�䩪�[�> y�.$|�,�m/[�;`2`kr����=g���.����d�õ{�l���* �2t���g��d��q���6}k�5���ݔ)s�l�2e�������[�%�t�\��ч|�hf{(����-dw��������k���;!p5���o����m�-��(8j ����ot���~��<�cѧ��|��ϻg �m��y5��h).i�%3��n}w?au4c����8����u;ת��ӕh���^sb�i�e�x�ɧ,)n��a���|�w-k�۶�wo������� c_t���s�|���yk�7���>)���r��tmo�t��e��e���}�֬9� 5h���� ��7��b����r�ђ������]�ى1�"��m*i! ���"��##"rx� r]�]�[$j($���$��8��#p�^<�o\l:����\� ��u7��}�>{�>�}�w�w�/�w?����cܳm�w���l��{��5,xĺ��x��)��/u�\�xe�の�����)��f���9~]�*��Ž�l�*��^lm�ق����� �b��(�ۭ�ko�تx|�q��f�w'|����5riʬ����q�}���ۮ;8�y���c�n=�_n�����zwa~����o�z �يmt����>�y��a9��{,#%|*��q�1�w��6���{ o���҇�sn�d��՞�'�ηyb��do�j�^�d�m��|���чئi(>�mlmy�����|v&��)qpb,��tx����/���~�dd��0f�o�e�� �&�^���_q v�u�& ��=���'�w�����7x;��v\��5���6mu�� ���q�ˆ�����z`�e��m�mﲺz��{@����o9�~j_�a�s�]�?f5�h�z���j�z��y�l�s�������<�=�����=�v�v��y����콺zz�p�����f�h�h�{bk���)����c�c��'���~ �,�5ᇙc'�a3�v��m p0 0w5�_��m�f=v�&\v�b���1�e��`��fh�â��m߾�qޮ�gm�nʔ)s�l�2e��q��k��[�lt��[�m%���-�xմ�dya���@�"�[adf�������0�0�5ê��hk���h�d�pb������՛��5�up�b8x1�y~�d���zn�b� �cg�u?���l݋мy`��a1�s�u�������]`�r8�0i6�<�]��{��ӥ�e�z�2���qxl=صn^ 6m����;��)���0���vm��t�(ؘf�3�����༅`�x� b�?c� �n����`=� c s���k� ��k[u�>e0���ߠ^�%cee��0���l�w� *�d �,&u8!� ���`�60k�v1������<n�l^ ֮�ր� ��e`���'���̅�uym"�����)�ǣǥ�(��d,�t�x� x��_���bk��� a�vp�,���4© ,����`�z0e�4 l�fn����foa3���fo�w��ws�96\�*��jl� ��bkv�777.���/h��m%ذ�[׮�tf���t �x5b�8η�~��n� �,�����%`�z��s梽�£]t��q�1� gկv�z�tؒ�^�.��jk�qdwe�`d��fa5}x� "1j [~�9��� �,e���9�ἱh�z�� *,@b��4�lyy�*j�g�0�u�#ш�b=����ot� �!ufq7 ɬ�' e�.�r���|��2y�i��׌�%me��q��*ked$fs�p�ɹ �쀋�3�͆c栉s��?�_f�=[@�%�5*#b^�,u�5��~�4b��tax�v'_��r�}�/��m�l��xi��5���5`�&�㯎's����/�`�o���53��`�b�s/�r�kzf6�԰1� j��c`�6�p�h�u�h0"x��? ʁ�p���(�sԍ[u�q�p$�y#� a� �9 ������m�nʔ)s�l�2e�6��h�[�6�˔*1�� �q(i�?�uvŀ�>!�mt��o ���h�v����ux #qe�* (��bu�dd��w�@$p�pҙp� aq9�\�\.c����,��/���)��$�ǂ�b�j�=ə���ũ��_�ee�*�h���8��m}\,b�>�����n�x:��9z��s�j>��'v���ըq� e[��i�����b�� šۚ�o�����5�@��0g ��|�tw5�-�/k.�(d�e����a��kai� x#/z�dw�њu���h&��[�� ���ee�$�-��j.3eway���ٮp# #*�������**� r��e�\n��o���lq1�ᕀe�����odj¼/�������b�[�$;���qou7�����v� bk�m�6a9����~���a/��j?��0����6 ����!�d��03�~��>�u�i���vu� �p�{,�'o|q]]u�yo����w��#}����#��c����b}��c��>,g��c38���ŕ�xl=�}b�<�o7f5�>6�����bo�������� �x������&o!y=��m���=j�kum]�zlx�oo�_��c�t ����_4o~f?z_?�@]?mw�rb\� a>��9u��`n?~�ړ�|��{�_������qxv%����!�i��@0�?'�i��b;,7= �^������ķc�۫u�v�z�jժ�rv��#e��/�{�ϣm�o�o�onl/�ȏg����?�b�|���f;�v��]����jd�h�z�fo�rku��0 ����0��n]g�0� �mv&�%���d�^�19��:e�(w�������[w� �[�jj�)h2.( �a�˲�:��i�v�#o9�����"������v9<�o�>�]�]�܋���d��`s� ǎ&�����q��h�nc^@nb^��fa��;cz�r:�� jr;��/����q�e 5� ��h�m�w�� 㨼��t�6�&߷\v�)����;�g�jƍv�.41�}k��n�jzj��\n��p�/2���76%�u�xlb�%ps�s ���#����wtk��y�b�v�΋h�o��h�=ބf�z���=l���_���ɟ�! �%yy������ʰut�}*�uh����pr�� ��_s� >�n�k��3p��w���z^s���x���vh1���� ��e��l�sk?��sjj�����g���o�å�2���-ӳ���� %3���`���tv��w~��m��/�ѡ�t��z�jժu�v�ګj����l�/߾� ��7��eݓ�xso*��t�����y��­ȳ ��\������ �������4>؊x�z~uɏ�ǣ�.����1��t ����[a}un*�������i���a���~������\��|������v����l26� @���/��v~�� �-�]j�`����b�9�"�ҏ��j� ����/��1�@s&ii�t^�by�z�z4دڌˌ v�c!x��!�� \ �����|� ۀm mmj����/�z�o:�=��hmx��z��.�����l�i����}!�i^�ϛ�h*�����h.�a�_ $���ڼ�)�za��l�*; �<♵hxl��@�n�;٨��|�vw����ѫ݇�~�͟����|{e��9��g�f#tt�%[-��ov���� ��җ��(�ɞ4���|����9�%���dy���pt�]� ni�-ғ�����b�8r%5� ߞ2g��f�h��2���q~��l�ɍ`g��´[pֻ�����ml�ʷwt����ժu�v�z�j�^)c”�2*t8v$�܉0�st9�w�9��� �d xhz���ɥ�h-�=�w��6t.j�mw��q�zc44�� ��dgtkrj�md���{ӻƨ&&�a�”�2ݠsg�m����#����#��d�t��v�dbp�ӝogx-�k�� :�㌯cz�[email protected] �yh31�#)ok�plp�ic�v{�"n�f����#<�ip�[email protected]�fj?�b^��m4����-��=g�a�_m�yo�y��l��f�_�!�/���0:1��eiaұ��s��lzzl��sゑzh�yu����67]fg���4�'8kűx�� ��6�#�<(�z$� � ��i"[email protected]�g-zp�rפ�{��%ӄڢ���=4�74�x�^ӄ�����2��y<��������$5` ��-�3좱��q�~=�ڧ̑$ p������vk6��\x��)(*õ�h;��/�vd���t�v<#�����<ԣ�]k[k��q˥���,�'���%�ҁ{�m�6�[email protected] q� �(r�k�}~k�������|��?^�k��8s�(x����e�e��/ s�qrm 8,��Ԥ��i0��3���!�>ibq��ŋ�$�q�q�n�l�č� i�$�!��:��u�c�ޛ� �#/j���c�a����h�? �^�z�jժu�v�2r=1b&�e�~�o�!�1���o� ���p��`n��� �. g��l�mail protected]&�d5�h:���ݥɓq��j=h��~��֮�8�4;��k^���:��ps��� �&������c�%p��sѯ� um��*���c��g�}��8ý����-|h=?�o�� ��6�u��ǿ�ο�݋�_��g�혿œ��j�|{e�~6��!�����e����@0$9�"r�3�����e/�fjӧ�r��p�����/r��� �j�7wq��k�p�x��l�;|�uҗ`��;���wx�%��|{��p4������.i_�k��^�v�s:9� �^q��ʷw�v�z�jժu{�����l1� h�d,|���u�5&�q$���w���|�a�� ���1��~��(���x,��0��' �;!��(l�� gq$�e1{��2�v "hvyga�"&�ǣ�~�6ǹyr/2fr��"z���t�%j�kr�a ���w&� �m޴yhba��fsm��[r���sٸ��㋈��է0�[��h�͖�*�͞o��� i��}���� ��#u��q��=����þoo�d� d�ٕ� ��yh|�[ė�i��ޡh���l&���j#3 g�i�>͘l��m��{�\����,��9?��ѷa���#qi�8�h����}�j��^�`il�[x��vh6�z�a>���5�e�y&�$n�f�k�,�q�ƨ�e��$;px��%���$��l��'.i���ug;���#�t�0d�m&e�b�1z�,(�qz�&d;��kj�f j"̗.g�868�����h��� _�{*�s��vt��߷��h��b�6s�%d{',�~�~�_y��~�/��4_g���)d�7�@��'~�ʽds���e���%�o�9����x. )�)tl����3<92�%�(������^�ri%"ey�%��xw�f����|q���8m�vi_�d�)�(2x &�����%��* �微'�c�!zc �º�, t~�dɉ� ���.d.�}���`�w��l� �t� ����b���y��ժu�v�z�jժ�vhoj���=��(�͔��� ߎ"����av��攦����w�%�-5���4��_y ���.n��]�gsp�f~�p���=�e͛�q��&dh��ene�,�ax��x�r�sj�mj��f�� b�&�m�bh�hp�i4�y!���q]��b���im��;lz9шu�ڏm�k��r�٤�����fr �d�&y[email protected]�q����&�aj'� �=�?h %itݓ�l�3���@}�.os�� ��h�q�#^t�r�jbԁ�n)��>����no�a�g%����}lg���'q�hb���(y�7k�cr!�&:q��[���@�o�j��<���dc�4a�jä� ҙ0,`��������cn���] �db~f!o�鉧 n���8�q��(%-容��l `k�dmi:�s�kn�i~j�w bu��4�5)������~*,�b�t�f��#�ȧ����@�|�ʣ؃fp���f�����/����w/�u��h���$e9��u�^qqg� k���2:e����x��<�b�ed�>e�c: :�z�<��o[���q1�^��о��q���(g;��ot��� д\�d�h�`������4���og���0�g�����)��ȯ,�[���l��8gy 2����)l���/�/��3)�7�(s�۫u�v�z�jժ�fd��4��s�;�l3#� ��3uv#�$o�ϸg#�`�����ft�~x����&q��3�.�thb{>�|n�4=ɀ�'��o�e!0���jyd�"�x�v t��~���fi��[�kt�dj��;*�"�f��aq�m���r���n}g�g�fm�ͮ���c}�&9�d�� �r��^�] ŀ c�o���s�e�(�y` �y���#yh'q���h"zܒ�d� �3g� �^@7����kj&�'����m�=�{� ��$�|o�p� sg� ��o'a.��4������d�� z�����4���9} ��@�9���z(!�o��y��w�;cq�x��7�yuyo�a)-���}�ob�n7|{oz������o�[�~��6��ʒ ���g�o��o�h2�"u����d:��ρ��fo^,�.ll�ۥ ֤۬�{��&�sr��s�,��[o���oa�ĉf����b�� ����2��0n�r:�r6�%a�ij�\ �i�]���ch��o��r����o�"��t���'7������b�������[s_q2����27o�ylv]b�lv�4��bàк�n`qm�ei�/l��l�ī�΅��)�z��e^�b���đtp_l�δ;ފ^�o�_~��_����o�d�����o�v*u9xɖ� ig6޵�_lc�e�ɇ��u��f�9�*!��d �~���a���`���6���q?,b�4����9e)s����j�y���k�<ό�͸�{$�u��mjvq��k2���dcw�ٽ�bt�k���9����h��w.ed�o�x�v��|{�jժu�v�z�w�h�nj��� _�����'����~�r {��\t�}k�8�7u�l�b};�� � ��< ��hv$�����i�r$�����/({y�1��9�t:8�ݒ��n�9z�6�0��" �c���?���u�["\��@哂�� -l��h�y&ዎ�gґ7b���og`k�<&o��!�����׶ ��,3~ƌ����=�3�e�'n��"��w��t(븥��$d�p�����=��{#��4d٤�ҋ�4 _a��}�1)�]r��]��njhh�p�r���a~���w7�z9b~vl>]�@2�t�m�7i�c�a p_�͟��ݸg��-�=:�od�����ȗg��|� �d���� n\z�-f kr��6�r/���\�6�igggf4�d��>�4]2]ҝ���p������� �]2�q�c3�$�7���g2z�!6�0�a�zvd�]f��фh��n4a�vchp�_������g�煤-^�,@�l� zicyp����a��ͼ���߹ȗ�e���n�>� ��]7����.�(w�'�𳵢�bh�v�4/i���j )2��vr�ۃ 8�phe'��$堇0%�xe���'����p��b*د�b���8v���l����c��%'�9z)b=]�ł$l��ܓd��[�[�!���p��xhv5g# `�">�b�*^5��α��ժu�v�z�j�^)�b�d��r�7�9�,b�i���zq�wj���-�/�-:���^a�#m��= l �7 p�tg�����9���.��r^��n�a�u�յw��f(rs����� t����b��xd���h�#�#5��v}be�f$�s���z��u�-�e� �0����沇�h;ks� � ���q}<��_���&���e��by%�0����s�. ō� ��de� ��� �i���j^f��o� ��(�~��6�w��y��q��\��&��jnc��&>�i/s�뻝��[ 7(�b�����\d�7�v��-� r�|��,3�x�z%�n� ���#�g j��کu��f�*-�[~����䚫0��g���e/��i��f�57�:�!���y4��h�g;� f���� ���7���c> ���9���k�~��}�iח2�x��0=�$q��1� ��f�g495|�~����w��?�k������6�g�#��'o��o{ycij�o؊���k��n�m [y/�"h�w�9�8�1q܈��uj۩n�®�5ʲh4nj9v�^j�� <j׫��q��|�s���z�s�wo��f9e�y/�*^��i4nӈ0w*�~�/�8��s=dݕ�u��bi]����s$��{u��w 4�<}5��ο�n��u�v�z�jժ�o�ƿ���������o���t'lcث����&� n4�� ����i��ۃ� /f� |�et�$�%aٹo��ng�l|���d�������3�;l���m��y��ymh�p]��/a��l��w;(�_�/i���}�� �q�=hx�o������j: -� bi�yzr3�-p��o/�0�w�� ��o����q������wq<��sn��vrcb�g�:�e�m�9 $w�j�e��b�nwk��콽�k�ke%e mmj��jpwn<��w�=�d�ds�u�s���5i�h�t 2h��ӡw��[email protected]�v�2v� �q��9�8���*l䦸�e�_2�r�_�倒�eaߖp�k���v*]t%{�������w���\��ժu�v�z�j�^���lºq�yh9��b��#��~�����y���� � 擜o�a���g��r<�^^���f~���8a����$�����?�g���&��p��#�s��g�v����m<��ih��no��)�f< p�㙋gc<�x�(��f8mp��)�����,�i��*iff��%��@�o�n1��p��i7�����p��#<�[�p��$��ʛ÷tr��zߘ� �ɘ����r���d��d�'��}�����]x�ob:i�4���3~<��w�g�����j�:��o1���聧pz��| ��q���.?��;���� � �w�o�v�:<�t�^�'�;i=��x������|$�h>��п���m�w�{;�3�g��1�؇a\�g䓈'�#��� �㱋>��lӄ>��a�2��� �]�l�)�g8��r�pf�q�s�����@��7%v8���a|���#�5�ǀ��n� ��dl'��u8�� �9���l�h<�ފ�n��zp>�}����bz ��s��p�ς��4�9��2n��y�&.��g���s���,���d�%��՟�g�}�ѿ�x��=�!��q��a�1��q����t��q�9̈��w����gb8� �,�>� .��|�,�<����s7��ᜆ�ɝs�1e* 5��� k6g� ˮla�0xy�ea�@��o�'�|��t�v�lˁ�`z��yr���y��� ��9� ���lz�_a��qh����:p�p�z ��}�[��6��1i�j�x�����mju��z�jժu�v�� ch[email protected]̄yҽ;�r�r7�]���z ���%��o���;��������㮒t�_ff��xݽs�>��]?�\.wi�g�im���!�ه�c�jc�� �o�������������� ��,�m]w��n���ʛ�o�\ \ �wyяj��?��\se�55ס���������v׻�u���3r)�h �z��^�jۄ��_�/%����_�7�rg��go�������}��s���w޿��ձ��k�>t׷� ��e �!.\����(�ၣe�_w�⮝���cx���@��sַtr}����v�>)ze��hi��=_�tո��p��^���p��ws�i�����e��m��(�pxc�?��m믏�f�n���e ꯉ��%�f���9bt���so�5���� ���|����q�=� �؍j�uw��g�<^���h�ѻ���z�_�(�&�s��t��. ���j�l��i}'�ի>��wb��𚃾%^шdo}��u����%�@a���j f>��yk�[w��7������� '�_{[{��g������9�436]雖nz���f�ݴ�����k�������|������s!�d���>��wm�'�l� ڌ�b �.w�s5��p����u�{y,��y�i ��bduo�ʍ�ҽ���j������>���͑n:�q�y��q�}���[������_}�׻�wdžao)~�� ƽ�4�_yb��d��n7w���m�]ѣ�x��senzkeb�m, �p�͡���� 7����a �k�����ćw�b0��ʴ[�:��'�%�o��=��^���ދ��y*rd�ʳ��՗�x�,�� ���b˲���4��?�]�ci�{o��`� �p#|����2��}/m#m ��o#y����:�����[�ҙ�o�э����j�d��� ���pb۟�p֪���n'�1zz~r� �����(ǡ��o��?��ǽ�� ��u��t��r7l�[��*�����df"��sv�o{~wf~m'�;�}����zf�� ����n��r�(�o�8qn ,^�9�co�,�k����m&���sbuq6�h�{�;�&5�� ��;�`g^�֞>�^�^ae?����3?������-�ǟu�bt �1ֵ��/'�}�t��l�y �c �ӷ�q�%��1��\,���e���4z�k��@�w|��g�2�df�ef��o�|{�:n��d:��jgo7_���ad�z�=�q��� �qs�@�� f�9'��p�s08{�b,��^��c�������~b��#9:�:�n�u��j��ȝн�[n>�񁎔r�%�*l����d�v&�]��'αp�b����g1�& ;4����ľ�h����~'o���q޵r��s ��e4p>6�u���k��r��sft�~olp�&4|���!�ƽ����� {����s���v~��c|����l��՝w��ur��1٩ �����n�r��;�*g����?�@[�ʒ7�-|���=&3�d�q�i��4�j�h�))��w�z������qjɜ�| �~�σ��j�g�!�a�������bz�2�ޙ/߱|���� ݭ�(�x���ĩ��� ���|$ ad�sw�o�@^�oot��9�=��>�֭q�1�vx �^�vq;6��/j�^�_�q���[��h�g {a�5��ɰ��>���oa����ǀ�a�j$҆��3r qc����c�u��c.t(帨��ˀv��>p�8s����r"}�羣6 ���{(%�)��ʒ�a2�y��u�&�t:��3م̫�hů1�aw�7cƴu ���iz��{�^�oz��q�gn��~-f��l]l��w�*��˒��h샴z�^� g��.�%�z��x%�dm��ﳐ�7�d�zv��z�2�r�� ���sׇ�s\���w�]e��zz����b\� m��>4�������i�#*��[email protected]�ꔑ���a4�^mm)��hv}d���c�)�?����/�v���j9q���ӵd�e\��vl� j�,s���їn.�z/ �ky�.��v� u���߅p�j*a�`��� 5��p~k�gpi�~�<�:��y��c�ynç��d ��?�b:$�2м���f>�,�*ў�p�!i�v����u�6,� �vֹh..�r�� mm���bw=��=��b0���6cc��:���i�f�g]��4�ܑ���nd��w��� n�v��"� �̷s:k�@��q��l������'}~us�t�m��j��=�{���$�>��y�!�!c�n �i/�$��u4v�av���g��*��fm{iq�v�o��؁_7���ńo��tb��p��v�d�j?����sљpƽ��olbχ�oom�me�q�f�ϯ7�3i��k3�ƒj��z����t�^�%�\h�@j �c�ao��8d�m���y%/�rq>���g�]iyq�2�qw-�r��俤��a�9(������g�j3?m��� 峴w��e��db��]b�� |{�-4tbɼ���2��n����e����{�����rldǽ�3��v���=w�#���� �k�����3�t��k )p���ҧ� ��\�����y?��5���@� z���>����ab�y4p����v�(�){��u���%n�����4 �k�y� oà~ ���r"`۶���|;����f��nu�υ�rm!u�zւ����$��lf��ı=�pc���pvx���j�n���e���\w�����y�>���z��p�θ���yo%��f�%�np��c�v�j�|��a:� ���w.��:a�w"����۩s��.a���° c��u��c�hr��r������b��e�x���ۣ4�������"y�φ�cb��\���^��l belpi�<@��� ͼ�á�|�j�<�n�a��n�3ݳ|k�x4�ɽ��aڝ����s�e�=[%c�ǎd�wk��q|�.�է���-�w��਴���f�m<�ߑv�v:8�u{/�m�۽�%���g�;��go0��9i����|��jwg���a� ���cg�=�a�jr�hʷw�dr|k?��r7/,�?��ع]� ��{9�(�{��p�y�a㆙|tk2} "�� qe�{�s������/���֜ӎ���h��.z%�u��ߏ�>�gp���4� o�@^vt�m|;��i�����5��m�t�6��@�\ta��at�ѭ����[�k�̶ī�\�%�%�\[xi>0.�7����z��\������j�o5$:�ٔ%eò)���x�kb��ml��x��o/d{���k?���z���t��l���*�t� ����izj�����fэ����t�\�b�oσs�q�t���!q�!o�%��n��s�6}7̷#8݌oos��f�d����j�>2 eb�tk���0��&(�~ܦ�4���̎u�[�ۓ��4�m�}�3m�qg��q�n���|���y���6���c|���50q� �a�^��g��l�i�"m�tu8�=*ߞl��d�qi����t�n�;o�:��p}z8w���p��uuh��.z�q�^;;y����y�q�`��p�yui����w�}��c��fh1n;b�������b�����h'|;lx���.�f����v��� ����膾��i����`_7�ov�=����os�6���%ϲ��!>h�zu!�4 ����e������i�s"d%�hl9��wo�c�g����e���r�(��[s� �>۔�$ �x��]�ܙ�j���� �գ���|,uh���@��\���o. � ͚ٮ�q��}��qk���k�l1%�y�v�o9���:g����v����;�)�td<u��:�ȋ��e$k����7��b�3�����*-̦��2w0\�ߛ/�7"ϩ�ߡ�"ɷ��b� �$n y�o1 �d�6rh磟_�cmj�� ��|���)�$yj��tl4l��ѯ����b�yq�m 3�;�h��� ��t���|o"���ml��c��d��`��'f���0� �z3}ń�'�=� ;���bc4u�b�i��n�#a/�,=��ݾyn��z퉔e���[email protected]�a �̷��rt���)�m�u�ā�rs�� q��,������7�^���i�'��,j4͈ʒ�\��y�>���'iu����4������r��c��k"��y�,�"��*v�)> 2�s��r~�n�{a����2���i�$��"t�i 1tb��itz�a�t ^��;�v��<��\�esв�j��թv9�� ��d 1*>1�ew�k ?�з��r�����g�3�v7����9��~��'•u����t �����5�c֚y�?��t:t�<=�?�%��v-���*��7�u1f�,'œ�ѧ���y.��g(q"i83 zb겶y����>�y��3ky�.k/x�f��r��^�y�zt�t��a����c=�=� ynٕ-{[��jj���t�cf꘼����"�sj >u�}�*�a��7{螐�̒����=��:]}֩�_����m�r%o �f���"n�*lq��rqtʳ��>5�8\y��ֿbzcxb�e��< �t�s��`�s/6�*q ��\^zk9��t�h�w*>;�:�g�l�1l�h_i�� n��j��m�i�=lb7�/�ȷә|���gf����x�j�k�^��[��le��ʷ�q�c_ɑ~�j����j�f��v� ��� �k���!qz�ȷlj�͌—��� y�>q�}z�|���:~(��x(a)w�m��1����������wu� q"əp�z�uc�޼���b�a�(��@!/÷�e&�tax�� v�o��y�~/cc��o��~!�rt�1:k��px�b�4��-�[��p�o_��>i;�4f����mm,|�vbޭ�η绝��к� �o_q~j3��8�ϸ�����u��4oggʷs���k|{���ܹ�� ��<�٥��\(���v7b�������$�z���čig�sy�l���*^��8w�(wt1�9��_��[jɽb��l���� [email protected]�d>��g�l4,ᅂs(��ٌ�.�c>�d�:�4$�~�l�� �?��2�r�嶮� ȕ�|�k�� ;���p�f�2���|p�n��ӽ]xkz]��qxv�?���b�r��nj�fu&�l���k��z�4�z*�u�y�e�y2of/l��ja�����ɯ�r��7˽吳d���*��f�l� :3�a�gn��̙9�%w�s�ۙ��� sť��/j"���.ilq��u�"&�"u ��[jp��(f��2�;���p z ��i�aү�[���̜o�݆<��i��h�5is���c�c�p��5"�i�����v� s�}�b�*���e^c�� ��2��yn;���˾ �mh�3ߞ���t�e��k��}�y�7�^���q'z�ՠ�`e�nz[��!�����y�����i:]�e����a��g�"3��f>}��9�i�p��:�6d��ϟo�r^ �[��qh�/�o�*o����-t�|{���l7�u����c[�� �>l��ا%�^�/q��ȷ?as��g����k�7���"��r�rm��}����w'd/�@y�ì�@�[email protected] �j<�o���p��ɷ���q�1�>���f$����x��y����v�luy1=�����y�}q̝�: gj٠�>�`|�n�?��^σ��|m��~�g��yx�o���g�����*ˣ�a�_xj�t��@qn��3?� m3�ͱ���������θ����m�@� ;��y~�}�� h{jxu�*o��k�/�sŭ�m��������� uڍ����1s9����i���>���p���݊i�|��x��[m�@^y�j�nu��<83�g��ڧ��抹�r�n��w~"��3�x٪��e9<֣mg,�����0��$ə� o���e���^ل��6�(�~җ��_�.�fݍ��||;�b�]��z�'n�ov���~ji��/�o$plܳ���~6�4�}!�̷��.v[iʜ��_���a�ݘ�r��i|{u �����r)�o_-�����x�0��b��c��(9oy�<�.� �}ko|� |�cq|�'�t�����2�<�c�0{|�� ���e����������o�~"����jf�ݟ�ۧ�{�������o. �6�=�~ol����5����ӳ���&�� ��˴� � �t�ke���� �z{]o!d�gjy3} ��uv~�ೈəu^�ѧ�\,���p�/w��0���}nc���x����ֺb���c|"�ˁ<�l����3amb�l^b�i[�a�b��\�b|�*���|�i��ӻ6�.f�u��z�����1���v�h$� &1p��j��8�3���]�آ=ܞ֙�uc;��<�3y`��l��ּiu e�f||z�`�*a�t�ݪ�*����i7��4��py 5r�ooրv�uq�ɷ�f����mb�z�nri�1��x8�� �кl�o�k��"1ș1�r(�oŧ��oϑ(t���h* ���9�w]z$���\k��)��^�s�>�����t۞��*%i��9{*5�o�o�fr�v^��1,�vjŕ6"g�6�g0�n)�n�f3}�7#i ��?u�]��|{b/�� i;/oy��$�^v��nz���o7��jz�|{*�k� gķ����˳�>�u-\��0�k����kόo�%�^;e�}w��v#i�?l��p�o�um^��>gd)$�尙�ϸ?�oo�f @��4�t���3��e�n� iuh3�y�|�$�x���� "������dy.�o��ۜd3j��]4��45�nj��e��q���\��p�e�"��!�92,�?o�]$s�4l:þ�òlv�!�l3¼�f���q7l]^�� |��x̠���խ���� 4�l ���}s!����qi}�v���j�vz��~����mf��i��^�z,��h ��ў��{��e�⣧��~!�ι�`n�w�߲g�]|�a�}��ߟof��&x��~�15-$:2ńg'|������w�e������dk��q�)73�]�4c�o�o���f�̷�{:j�1y݋�ǟd �n7_�̌�s�v����y��h��\���x�y�'��f�?ؚf�[��$�������*��6w��/̷g��;3��d� �t����b'��� ��t��~'��'%�il�?'�}8z6m�y ss|κixڊ�qdtb:mɴ��mwj��|�kj��[�9q9p��ö{������ef� v�k�]�5�0��ս����d�]�g��ӌz��p&�r�v->z-�nˍ����ޛ��>�s��7���,a���w o]����n�/>��jy����^q�u�=��ix�����xc-q-� �� -�����(����7k�q�i��l�tmǭmu�h��ce\" ]�n��m���-� u�]hmu����3��mڶ�hf�l���|֙ht��� �&�k�ѡ�ñcܗ�fh{tŷ?�2:��[��ά���:=wc���ujgߛ)�v��)��d�}�cr� /�ƿ�o��0��z�c�j�h �gœv�1e�l�79r��$��s���k4/93q/ʷ��oo���o�k��.ݻi<�q�ݣn�婳qs�n�͈�α(�v�s����-^ f���mjbt�3�m���f�c��۴i��a!�%g�9���6pj���vܗ}���8��xjt�d;����ct/����if� ק �� v7���a��bp%oy�r�����c��/*]�de4� t��'�$��|{=2�힔w�v�� ���m�&���g���=�}��oj�b*6fwr?zâ�?�{�*{��^xg���,i~&�s*kx�z���뒭m(d��t��t�v�!���q �a�o����2�.�����8as����̳s��g��0w|�����e��p<# ��#���ww�.�ų� �sb&�}*g�8�>��-���υ��o-'r)ۏ�q��i�̈�@-�h�=ruc��7�tt�˷muz�k�qvv.�[���ؑ��p����0mq�^u�*vb�� [ǽ�j��"g4|�va]6� ��y�<������v�3�s���|gs�ݳ��)t;��:x��޾�]� lja�?�cv��]n��q��ȝ��a�"oy��s��u��g�omuq~��y��o"97����|��~�k�w�����ëѭ/�i$ۗ|{9�d����d�[{���g����ۉ����(f��k[�>�wvu�4�1�]�jkk�����-�f�ty`�]����4���'�ϭ�!�s�����ц �č�̷[����]���x����"[���4�o���ߞ�y����|; e#�]�y^��b���egh�s���o�� 㻆��h� }4��\n�;��4�:;���䭄q��t����1xk�ͽh������iv�l�v�w��b��g�w���і���)��3�'�v˻�[������nx9;ŷ���mf�����6�#�����(wu�x�8�jн�ft��\��~ʒ� ��b�0������lo��[�s�z����n�ב��1k�������l�2z����*gu��v?yd��'��r��nk9q�΂������ؤ�[email protected]�z3�ۭz��8��ѿ�۝��5��1�j�)�a�te�"�)&��`�t 8�4 ���i��-o!|�f��|{�s�-����-������bz��ӣm��|;[��pz��g�x��|���1ݒn�76.��mail protected]*f&k�d�v���m[�i�z�r�k��jks�t��gr��k[]��g }���x��|� z)=���6ˡ�^��!o������52��z�[���x��������bk�b,x~�^]��a����n�t��v��t�dhj���ǻ쭆�@��nȶ�ou�=��0ݤ&��m�6j=��^�]�>�o���#�����z]�?� gg���w�{#i�{�ķ��u�@����s��,��q�yu��.�����5��ך?�\��q�9t$2mo x��-*w���s�o���t��ɣ�͗,?�6�a�����3j�km����&a/�.f�qu����>�%ꎹ)��#|��|rcek2!�z����9��o�xb= �ɷg��%��pl��7}���j���v���l�ai�γ��ow�c�j� �u� �k^2�ۇ�io�ǵ����y-s{x��|_η��93x:\6�n6 ������ċ쯬�w?�v��/�d�f�f�=xv.[s܉�c��%~_� 1vl��h�p���vi���-id�y �3����k|{\j����� iz��w �~���5�}sv0��g��ֿs�=t˺�[a���$���!н��\�c�i�y�z4ߪ�ȗ$_�)��j�j �ȷ�"�p���;��y�0�jӵ�҈����w��?���� w����/������:_��?=�1��-"w\��>�}��������k�ݷ�����>ut�6�ҥ�p2y8���ti��s��#.h����z�c �ԧd����o��s��k>��q�b����қ4���nfc���}�u�?����b�?�}���)�_ڀ�n"љyi=�#/���m4� �xw�i2n4u ���_��_��o�/���n�y�|]����? ͮ�!q3ѻ.�n��]h߹×���o?o�/��_��_c7��ne%�=x�zn�n �ɩb�q����n������]�?�����k��o���;�c������h�pb�� cr���ct��3=�su�wu�=i`�w8׍<� 3u;�����[`��ȳ��&��w�%��'f�ʱ�꡻s;�x��g ��e����/�0�'op��'��.?ĩz��fo����_0|��cbu����(s��ޱ�h�ѫ.g���9�k�ku�3��d8qy��!h�o��г �$���v��p!��ժ�2 jyh�n��qa�i�l��[%:�k2�ßi�t��6~l�"r"� �ڼx�/$��_%��/�*�a���h#��cfn'�,e���e�m3� �ua�w�}q�q����r�z�^v���ϡ�yv%l4�e �(�����~�jw�/p��[eq��]�jߤ\7ŵ���a�ߓ�7����� �r����<%�r��p��絶��d�~�eul (.f�l��r5 u�8�]�席n�*��_0�a�7���t�r�~$�����?�`w����*��b��.v�k���h��tuo��,��/h�^%va1�,�~��|��[email protected]�yq˼d냏q�j��l��5m_�y���7z�xv�;şfp��w^��q�.��]��z����1�b�o����p��ѩ����r�! i���w>%�9�ϡů8�ͪ�w �����kg_�� ]h7)y9` pf� �1����_�����*��e��ʲ'qcs������n�9�እoitcι��<�*cae3o`�$��z���u�e��|s)~�q��tဟr���0=�ks�� �7��_��:��<|�z�a���a��܀�kjҫs��y��f��,�;dž`ă51x :?e���s/����y�=��cm>� ��9e��o3�h݇ὼ}3��#�gƾ�� �@�0�����s3o߂�g$}mq� ���~)i���i|;���~�o������v]x�<@�x�4�v,h� t^�gy�nھ���a�%��@o}r3�� � @$�f}|"q�{���[n��q�~թ�k?γ7�w���m��|3���iߍzw���$|�4���������is��y�n�uϭ8����(�����v��rtfh]�a����i�8��ˢ{iw#�@� �0 o�i�1�$z��a�^ֹ�uod��$�k�w��˳p_����y�q�7�}�u{� ��k]��.�)pk�����y �)��t�!��a�n��� q�|f�n�cf��u�ǭ�i�a�y���ejud�u���y�q޽���8� �����;*u�m�ist_3�i�z�nt��� ����a[��*a��su�g�\��?w8x�0��<���j��;�y'����v�^�ou ��*o�λ��k��pog�2��fo(�ѹ��v-q��'�{gwh����ŏ8lqn mtxy;��n���cum'�ݤs'nm���\���k�>'�ʔ� ng��i�vһ�����j��o���\�*� u��x�`a= ��ұpj�,:����{�����zn�d�"p/f�gf�\@3�颬&>m�^�:-3*�j��q��#)c�0y���#�rb/g�bl]��' ��'d"�&2��eqr���oy~�j֎�>xn���թңi!8�ݏ`��\�k���9� ����(k��ou��헡uxq���!�h �#{.��ƹd�\b-�������j��]��j@���{vվd�|�r����@��*����6�n��� ���6����ľ�6�� �s��.�ț\���6����������zν��9ˑ��w��m?h�յo��˱�[email protected]��m}8������g� �mg1t��r �>k� ��$wv:�qї��8��s����m��?����w؏���]^u[wg-�;�^�g�|*�@��0�v�ɩ����jj-��e�ν�4~��[`e&�˱*z�=��d/�,h�� ��x�-�9vq�̷w�=b�,x9�z�z�]�ٗt(h×*,����y������7��ܚ��ڬ��l�$��vutc���п[��b�qag:o.���4`z��n ��۩�ƞ�ê qٟo/��n���v�t��~⿊웱��8�*qd��<���-)�\fb�<�5��x{e����u�* _��ϙs��֏�sxk���t`��j��"@b=5���l�� -ѕeݮ�r��0v�x�s���f�e8y��ۍ ]k��,u�嶻w�q�q���c�_�5���y���d�w h q �dõ8)t*�#�evڼ�k��;����s�@�s�������7����@���˧�yq���w�¶~ԩ� |�7bg��,w����jw�z�ġ�������4?3 fby�؅�ef%��^u�u���su�ڨtb���~o�g�멽�:���:� y!omr��"�����0 ���.�p��w�`zi�v����_�^��ӭeh�e�w�y�9h���ϻ�롽� ���8 ���o����1�pn�o�qlm�1��i�lzj����̙k���=�: �=��~ ��nd��1�"�>^��u�����톓 \���ɣl��m�r�]i{;�r�q5q�hk���f������`k9�>�:#�\�9��^���p1��76�r�r�j�(�������/�b�6�z��ͽr���5e��tn��uh/!�|n�o��*�}g���}��v�r 6���dɯ�5���=��h�r�� d[�v�l̓ 6i��}/o?(���6i�g��y��k�������7����qm/��bn_��`������\����!�����=��s�5vf3�j���>ގ��vy�v����y_�1�sal� ow�b��f�zͩn0�z3��e۳ؽer�0�z\�aiz#c���>ow�(�ֳ�}�k]��s���8��y��o%�|{��k�$�f�>��p���bm�bכ�x�m�|���w�ms�jyfh=���'j����ɱͻ�]o��j?,j q��׺�r;�\ם��ƕ<�y׈v�տ�l�~�����b��f�d�5�$���9��-^�ǯ�� �w� ����dzw�y7q.g΅ȝ�)����s �q5�����i�x{��� /uv��h��c�~�ލ�1�5��lb���$��bp3�z#g�o� �>o?��y���ӽ݈4�ԋ�q�zb-��\b_l� y���rb���z꣬,���������0��-^ɜys���vv��%�o�<6v�����t�u�k�����y�q��έ������;$y����;�����=�|�]j�7)3�g���by���w�$�y�۳��v&!��� ʊ��0��m���r�2�b��y =g�wh�i� ޮ����}pgh�u�$���%ܚ-^mר�ܤ跸}��.v��57��ߧ�#w oge�>��yyhu������z���n��"v�g;k��rf_ȝ�����ղ�����h�jݱa����~na#���mmf�$p�1 v�tgsgj|�>}΀��tw�c����;�t/��?b�f�v���g���_�8���e�'y;g> ֙����k#yk���z1|�l/ԩ� �i��n��|�����(�j�wco5�.�����t�r�< �{��� ����6n=�;�ac6sgc�����8�u�q���vv��߼�f��_��ʛ�6�o��"i,g��y0�g�nww�o���p�l^��v�sw&��#o��e��ell�/�*��������o����!gz3���y�l0�v�ּr� �s�f���2{��y_��_��w��g��[email protected]��#isz�ę֔ ~dб5����m���a�i׽�s�`& �`1o2����vuk��t��΍�]jù(��s�p d�7l�����uu�c�$�~�i�k���3��\�^�� ����:�"�fo{ �ik��m���8������x����6�^筛���s�?�z�լ� ���8wxy��]b�r�il#o$wgq�2�n�sj��$o7r��ז���v����2�~��<�r�|ں���9����xڇ�� �"h��2լ=o�i�u���y%9��rߤ암m�w���� l��k�3�s�3y��s��� o7;xԅ⯞��cr�&��!�iڽ� y���3��k�5��pk�ă��� �6��s��*6� �#�(h�$�!� t�,�� 2��jԁc��4}�7�f�*l-�p���b� ����.od� �x;�u����tumh���o�#b?��%�ͥނyf�`�nshk�:�u�v%a���9�nv�x��rv3�^p�p,t��p�4�h���5���_b�c�%ot��>a\q ��[����msu��<6sz��svőr)��w��,k���c���d,��,>��b��d�xx;.�8�=��"���#�4]���i0 �1��ƥ�u�s��򓄁m�| �ˠ5�3q{��:u��b�b-e-~��v.�1��py��j���]�dwqpy#�;�~%� .r�no���p��dboɹ{�����l���mn�e���ť5��[email protected]z կˣ7�ukt|�c%��[email protected] fz᩸w���"�8wq'#uv��v9���1�(�*�g�c� b��ۑ��&o%[�y��ӽ1�� �@�0��q��i�ޝl���l7jut����p%{�������lqg2�wc�h> r ==����(��o�ʏk��g���t�����<��o��$w��5a�3�=��i�=b<�e4�_g��e�~������ި�'�;ʒ�ip�c��_�����v���wx{~��wݣ��3���s, ���c�i�3̽u,��e([email protected]��v3֝3�ȼ�����(�l�� m� ��;�� %���' �i m�y��k0���x����9�����)c��y:v���g��� �o��v���.ԇ�q�w��is�f�?m�ul��4=�]f[ܻ(��pk{'a�$ʓ�7t�p��񥡊���۹��$x�)���/k��9�/w�c�5 � �ky���y&����i���[�@�_o�˖ �����ͪt�c� �e���w :'agm�,�e�ƴ�5޾gd��� 5b j��u<���``e��ܹb�y�1{6s��m��ic�p�t)�}�]��r�jx{��e���(�����?m�a���y�3/�[ ?��bo� v�r�e��(d]5 �����ο�� k��% n��"�փ�ӑ7�v��䅔m�.z�j���v"���x��oë�̓i=����(�\���a���=���q�?��9ӛ&��ku��0u(�e��q�;s�;k��ěe�i���r�������xk43hp�1u�s�hv��lsx?��)֘��rob�$�~ ��v�j�&��������ȋ��km;m��b˃c�=i���i�^��}�y;ke��4��z�< �g��d۟���*����w�s�����/r����gb�^"� �f�0�oq�o���m���b1֘�,9��k��.���l:���lқ��3�9��e�ޖ�jҫqi�e���uk��a�s�x� ��$��y �����o�^����z���]���?gulm��(�g�� n��2���}p��������oq|z ؚ��pƒ���wa�^�&������ �}ޮv�� o�:$�d��� rglx��f� �hv������fcr��]x�7'��-wnio�;#|k�z�y����� ��:a�yޞ����p�r�&�α<8b�c�:&�owy��dž�w�b �qf��ؾ�������a�__޾� n�g���8�ojkd����y������u�h�����"og�k�߀��ob2�'"g*m_b��tf���<��]g#�x���7��q�`z�q{��mi�ǽ֘�3c��j`��zl�q�lo����y��;"{ x�3\������@����v����9����e�q%gp��wy{}n��>o�anfⴹí%�h�?�ۅ�dұ�t���&��u�/=�{&� �1&�3�?#�!��c�qƽ��f&��k��[email protected]��͛��>"�������ޏ8e����jٯ�Œj��nj��:���/�t��2~u�����l���=�!��0�"̿e o��"�|c�o�7$�r��wd�s���_$��e-5���)sr���� �%��naw�6�d���m�5owߤ����;��w?�ۡ#�ϱs5w'�2�o���^s.��q�a y����o7��xky�| �xhy\����������s���r�k�ӹ9���̽�"v��>?�)��8)��48a�#�s���5l�e�s���reo߃!�n�z���%g: j��t�@$k��i^b�y�d�w�;�� �}��mɓ�x����y2p�� ��6w�]�'��t������l^���h\����=*�3�9����lq�߼�� �o�p�ip� ar�bm� r�.�rh=!zl��/pg�[��:�sо���9}-�%d[�^���{��x�^7�1���4u}d� ��tg�3"�ٺ��k&�`��h�jy�k�.���v�`x{i��)sfz-lo��bn���h�[email protected] ���3��sy�2�/�l��_u .�n���.�l��x;�ab����[l82�5�� ԛc�1�b�p�����5v���p�����v�%��s�j���<���ڜn��3�s�r�k�zn���e�����d��x/tͥ�k�]�.��o�5���� �y��h$�;�_�� �k���o�p�d�ž�#u�n�u��дb ⇂�g�,7�3|����m��g�#$<*�!i� �r�].�ʗ�ñl�3����c%��`��o$�e�~�5�z_��!o/td}�oeo�gh�5��ܢ�2w�0�;� o�9��`��o���. �?�z�vy�bsu~���5��jd�2������ɚ'r�4�y�m�y i|�;y�wpk��k��������p�$����wur =����cy�я�ł�� �k�=��[�]�qakodge�i�0���h����o�� ��ǟ��`x��k}�݅?���f�x��]do�� w��="�a�e�a�<�:x����[�k�.\�^����^qv�o/~���o{x�?h��� ��}\z5���`�b 1��۵�e m����]��0vy�;��q�z� ����� ��"����cgx'��t�f�y� �q�l4pqɤ��vz�b�kq0�h; �7�y�����yb�#;�����(�y�}b�ǹ?d�oq�mw8�������r 3�.�$�z1i�(�̄h��9m�#wz�q��f2w1/x�h�����2%-�n#����2�a�����[gq{��`����4o/��~���g�5��������^��୺�_)o�b.r�����;͚� wh:#�9-�)5�s�ʃ��v[_5o/��qpx�}:#�;��3�s��׺m��9�m%����e�����q0��2�pg�燎�k#��ub�%�y{���r�`wz��y��v}�h�wҿ$w�猎9�q�:f�5b|v��u�*@i}ן��z��tー���η�ut�q�1i��߼]�c*ӏܿ��%�f��8��ɬ�b�!�� ����,\s���c�;���4�������j�h�u�vmlh�i� �} zw��t��d��; ܾ�7oן�d���9%c�=a����߸7�����m�b�o��������(�/����uݣ2���ioq�[�@@�o�� 6o��c�6��_��f�hfz1_��ˍ�j�q�����p|��ff��꟡<7qn*�&�sg��l��٘ȭ �{�o�u�fʴd(����/#��������v�q�>r�֐zq,�x{$z?�ƥ��[gy��� ��c�]ʁ)�xuo5�)�_�i��s��v�ǥ="�a�5*��2 l�\�.��ke�y{����q�pɨ�{�ju�i����e�4���2�[�%s��`��/������aַb��|dze�]�l7wqn/ }��x��n߇�y� ���e�o$ �2җ��=4�u e�7�d��9پ��q���,8���/�gu�re�h�b���w���psn���* � �?���?�#���9�# � &8`����p������i���i�]�o���]%h2����qx6b[ӕ�����b䝉���n�i�����uw����f�3o,ɕ�r�$>=&*���ga��d�$�nj ��1��_*l %xƌlo��&���ru7�����гb3 eʫ�����o&�d�o���x�_mv�e��܆����[email protected]�� �^�k m� ބ��٬h��#t�ɧ�l���:��悌�v�rj�np�a `ʕ�e�� ��貯�l�t�v}j��j�j��!y�%vfpe��k�s|�kh�'��� tu����nޞ��9�;ݼ�0ef�v�� �|<0-�� s?b�[email protected]>;!�m��.��u����b#t�%����շcf�l`4������m��k��������˱3���*�]�_|ⱺzzι��ӕ��# �sf|��:�g�;�� oo��3�� 6��oc���u��6���6����[= x�m���)n�ݧ`za�l�'��@߭t1r�t"˪��s]� @�kں�z�wjx���s1��ji7���' ޞ=y/�13j�"� � �^^�����b �fz��l� �{].��a� �c^����t��(�ca@if�hǿ�����3]�� ��%̪:bc�o��x�jx�0�?���1t��3��-�-'�m\�?xe>uq8nk�����"o���)�1 3~�n;�2�:,s}���0�kö��5l�awk�1� ���vilīj'?��b}:�=�r\n��2v)� '�x�. og�@�׾΂xny�l\����ڑ�[���ۥ�45��x;�ݮ�`ow?�k|�o������p=����i���ba�rރ������^��9y=&�ay��d��4_ʍ��tsޥo�-�n�]o��\��.e :�i �g��yׂo�?q5y��%�x=� 'q�t�d�yy����tj#sd_����m�]�ވ>���̙d� |��䁲_���.jӳ�vٮ��o���z: ��`"�mg��t���c��ռ�.6����3�^��hv"�l�o��h�n����>��}�o�x�%�4 ���q�~5���z�����e����ӂ� �h5�͞�,ff���vu�]�>�b��7��r��z��d�`�@�v���p�q�n�`)�=��t�qe\v�d�$��z��j1�)m �x��k �^�`� f�!���v��4r����ʢx9� ���\z��[!�sj�*:����x;�fy�6���}���b'�� �2�܏�򉴼��� �b�������]��4r/3og 2�<=���v�`�~k�ϣ���=ž��?��@<�b0�:ef�}y�@���c۬�� o�&���< n��0����`z��[ގo7$ar#�3/���o4��l�&������-�} �f�j�ol~i��������r�տ�۳(���f=��nx���[z(��{x�j�u��lg��ۣ�����a|6�����������q����ew��@�j��vf�r:� o�v���q�o��!�.���� ��n?m$�ƶp�� ׹7�ԇ�5��ī zߎ>r�6��7��,oulx�^qݔ)i�x�ՙ$ ٸ�� �#2����vx���ϻx{n�dy�k6�kl�`���h��oo��e��ğj�5l�� x!�ny{]�n��a|z\tnp������d�eƴ�n�x���v�������� �"��ޝmx{�ߠ���1�;h�kx�@ox�úa���e�o��e^v�v�y{��x����_|hy���o�{���n�|f�.����g����t�7 ��xs6����gfv�%\��y��ΐ�n���)y�j�zs���b��^�v=u�=n��uӗ�q�cv�x�'�:� ��vc�wj�k�ab�*f�������#� ��dp\�'�3�ޮ:�v]���]�͈��*'��t�v)y�-����k�4����saxud~~6n�ޙ�6��dž u� � �\d�>.~���j��\�� �����tc_3 ���k�����v0wʒ�.�#�`�ǵv=q��5>�)�j������"�̪x&u������v��tz�l�=awn>�0 n�v��ꢌ_�����{�y�j;���r]��u����� � h}ޮsk��w���t����l��}d����h�g�s�� ��&z����̈�dzs ~�]i_����h�@f�,v��n8��u ��t�c<���e����y� 6r?r����?g�[�{�if�7-����� yh��d���h5��#�൏��l�v� �=s6 0�u�gz]ajg{9��r�� �e�fj� o��k �7��q� ���r�h� `�r���r���j8�l{���ys˜���f�ir6]1ôu�ϟ�� z�{�� 0�շ�{�b�~!6z��`��f��z�ӫ���ؙk�@�h��z��^���h �!��fȷl�ߔʋ� *&wyu���=&�uw�; ޴l>�g3����6>h3۬s.fvt���)��lu���m��4o�,�i���{*v/ƭρ=ּ=r��d�����<ґ(a7�i�� ׻�ze��[2 ��%�pd���x�#bw�so��)=�r��o�d ��m��v��a�e l����j��n'� ����τ�a�[n�,x��eþ��k��:�"k�u�b���dk�~svu?��n�y�sx� y�o�5]e /y�ĭ�ltcrc�g���᪄�y��v�bw�^�o�\z�� 馵6'�j���(ӵ���k��� �e}8�m��lt[��r�m�x,��65gy䝑(�i��r� ����s����foy�zʭ�͹ ������k�g�˹ }�ы ����"�w޻��l�$e ؟i�a�\n�i��m#� ��/�'��>^�6w�5d��7�a鏢r�@� f�l/o����<��z�o�1�l�\�t<d�j��w:�.�5py��u�nw���*�l�{ ��z[�[email protected]�"y�"����m��(u�?�qi־�ݛ�=����{a�v;l�,�׭��wj�.�މj]�=-���~ԃ�j�׃)�{&y��d���y�:&=e[խ�p���ߣ�@;�(yd�h��/��¸jf�2��}�lk���3��t]ד�۱{ ��қb�l�̇�/�=f��;�84o���5 t$�['k��y4��7�p�wΐtƥ3%�iy���{���۷vq9&}-o�n����1d��l�����ptp���ߊty� �-rd/o�ӹw[�ĵ�]�m�՟qc�s*�hoxwg�x���\���ng�n�)_�-�l֒��oѭ%6%g���g���3 |ժ�3g:q.��/�y{���w ����s ϥe(f;�vud/"[>,0z*k��?�!�?%t�� ��]�ֳ2.�#y��,qu�_q��o//w� �v�!�5 �&�k›��0wn��|�|����{4&�npxw�df��5��|��e��e����ޤt�z�2mt�ui�w!����^�pdbe����nn��$��`u���êwui]����ܟg�h��淡;��)�7w����q�0sl�]r����k�r�x��spɺy4ow5�.�ԓ�k/�kbe��إ����w��}c��x��i�x�v�;az��ę�k�!�c�v�v����h`ul���xir nݓ�va��֦� 7e�����zv���h��q>ݼ]t��oϐ��� ���&�.�>���k�a�g ���`���9o�lߌ��g��yty��tftzڙ���ʿ��w�t���3�y{���-�au�l�7����p�1�b��]�dl�^r��jt�?��#gf�㪪�3�s#]��="���[�ϊ�4�{j��x�k!�o���r������/,o�x�[email protected] 1����擀�j���$�e�f�;͜s�s���'ݼ]f������ف�ς3 �qe�۝)l�-o�=�b�u��q�,t�qol�f� x�s)�$�>��e5�%����y�$�����bw�w�=r.qu7��ܙn�ki� �� og�s�ȯ���^ u!�hм�~�!�ǡ��3�ۻ�6ͭ�� �2o�?;ۖ�g�\�����흥�=�vl�oudy{��*�,ool\w��q)oo��k�>���p�r���n�������z�~�홗l�ۇem��y{����2k|�*s�l��j�q�r�y�t��{����m��>���ƀ2�$�ghҵ�v�,�����b(��r9ro<�����f���۽)pnb夬߂|mnߩu� {�zy;wy�t��ov߾����: ̽ �q�'�޹��ͱ��ѷ�o�� ��,vt� �nbo� �y;�u���s�<8�ҟ@�p�d��r};�&-e�f[�o�7��1�l�;���3���2��d|w��{�6n��1���ܬoo��\����g��'*3�����sp9 �3�=˝kf�� jo�v;����q[a�hx{�_l�ӻ������z���$s�^4���v��9o�m�[x{jx���>���b\wl8ӊ{9n}#�s�/e��ٟg��]:òzb6l��b�����d>�*7o7{*�¢�����cgv�awz�fۻ�^���u" ��[email protected]߾ُ�z��e��#�_��tyܙªj��d�<��urܙ��j�\�d�o��v�3շ�t9w�ōoe�dx;�[};};��sr��o��s���}�$��dpz��k�]�#u�x{�{��e�� u[�^�m�_ �|�x;hv4_}{w��m7�ѷ ;��ep����c�*x{���˓�b��-owφ.�lnu����o��׼]u��ng�\�x�oy������v��ov��:yq/���茡��v��ͣ�ۋ#���� ����j��&���dґ�e�=�5��w�q��c��1��h������j�i����5o���v'����g��#���]-n.x�j"�s�x���k���k��$5�8����܍�����;�op�1ss�eu��۟n�o�0���,�d� ����<��n�}q/d�f������1�>b���|y������o�����y{܎�y��o3���w�-n����w��"g*[9�1�v��ۻ�n�}���y�ۗ��o'޾�ڍ��x���}�׈�o��#��ri�x{�������9og��o�o'};���y��i�n����[y�$};���ѷ�[��w�-����o?e�v��;������'��o�s��}��c�vҷ��!}{?�wӷog��i�n���_�v���ۉ��o'�n��x��ږx��x�4�v��;��vҷ�x�~9����v��oq����!�~pv%�n��x{) @��x;�vi��x;��ó-�v�����˭��o/���r.��������o���漝o��ۏ4o%��~�,���ۉ�o���%�v�����߶�����oo'޾�[o� o� �n��u�e�}��c��x�[���x�m߾�~��vw�y��i�n��0^��>�����ky��{}{܎�y��o3���&��m��x�$���x�ƙ�v�ll��x��n�o6�}���%��o'޾�ڍ��x���}�׈�o��#��ri�x{�������o?};#};�v���������x;��w��o'�n��}�-����o�&};���݊���ۋc�}�����ҷ���-����o?8�o'�n�� �n��x�$�n��x��ٖx;�v����v�ۉ��x�~9����v��oq����y7޾�"z��~�vw�y�ۉ�o?��e��oy�*�v�z�.������؝�x;��7��hlo�ѷ���oo߉��`��l����ۉ�o�v;��a��� o_"�n��x�^�k7��#�����!�_#޾�����j%q��9o�o��漝������h��q�����"�n�v��o���%�ۉ���}�mk��=��o���x��ne����� ����_�\�o�=𐾝��oqh�ޏ�������vҷo?��e��x;�v��;�ۉ�o'޾��%޾'�>m��x��ne�����!޾_�e�}��c��x�[���x���u��o'�^ o'�n�]o'�n���lk��x;���r ���ۋc�}���x�x;���8����9og���9��#��g����/�x;�v���۷�vi��x;����-��=��s�ۉ���v�����'��o�so�=�o'���x{?�wӷ/����]`�vҷo?��e��oy�*�v�z�.�^��cw<����ߌ�c"�i�}g��&�>i�}'�.�q���3o'޾�[��ۇ o�7�}�x;�ۉ��źv��<"޾-o��5��[x���t'ޞ��:���:���b��h�n��x��,��o'�n���x;�ۉ���}_mk��=�ۧi�n�}g�"};���o�/�"}���o�c��~<��ϊ�ۉ�o/���o'�.��o'�~x�%�n��x�~��v���!޾_�e�}��c��x�[���xލ�/ꅈ�賟��]`�v�����eo�s޾j�]�������ap;vg�#�n���x;$���w�-n����w��"g*[9�1�v��ۻ�n�}���y�ۗ��o'޾�ڍ��x���}�׈�o��#��ri�x{�������9og��o�o?ҽ}�x���������x;�۷�vi�v��o�ے�}o��s�o'޾�[��}��}�x;���9��w<�o'}�[ҷ��!�~pv%�n��x{) @��x;�vi��x;��ó-�v�����˭��o/���r.��������o����==$�έ�i�>b���|y�ۉ�o'޾�����!�v�����ӷ����ۧ��o�٭v��æ��ǎ�1]"����lj�o�so�=�o'���x{?ҷ�u����2v�s�>lx�=�����"�n��x;�vҷo'�~(�%�n��}���غo����o'޾�e�}��c��x�[�����ma��oλ����p��.0�x{�y����3�]�it���ΐ��o/_���.���z����s�y�*�v����e�o�on��,x�ۉ��o�db�x����m�}�x�n�]�le g6&޾=ocw�x������o'};��=:w����9�l�>���<"޾-o��5��[x���t'ޞ��z��]��}qލ�������x;����eo�k�n�v�b��}g�����o'};�vҷ�mi߾'}�4��wշo߅����x;���p��x;��%��i��6�w�n����5��h��m< |��w�7�*�x�� �3��[2m�"�oi(2�� �&s�h�����r�j[r���)�r�s�nf�������o���,ov�&������o^x�o�n����m����pu�ָ�m�:��b�v��el�훖�3�aer�x�l�;,�qټ/s�^/� #�qvpa�x��wȁ�/ }gm�s�j�h�u���g[email protected]�\�0zj�_ �[w��y5j��o��2�^����zܳ�s!��i����2ti��;��c�幯�gm#tӵc�v��@0&�av=�87��υ{�v�d�fn����v<�*�ċص �`��h��"�w��k*�лdo��ȹ�~�s���3�i[� ��h\и]�=��&`��� 5�i��{ߎ�#����m�����fyva>ף(���p9�syx3�m3�l�\�z_�ȧưȋ��!�ꃊ�~���.�y^�=pȍ�a� ��:.�i骲yz��k�,]c�o7dζr��o���ڊ�#�y�g[����7��*�3�37��h��v ��v[|�����wc.�a;�*�zš*� �>���[�3^�-ry�4y�\���^i���mg�ɛ��y��v�e���`� �n]���' ��`e�o�җf~��zy��k�@�h��rm��s0� ���σ?*�)�o�_�;�w!iyޮ��ekj��������d� �?�6{� ���[� �ip/�^�4��ș�_b���.m�ȯؒ[email protected]:��l�) ��=�ts/����yz_g4u>%]� ����������,i�j�>���hdt��"x��2��q���e�w���e�d�8j~:s̛t�aw�u���=��s⚽by����9**�ǟ�� ��i���}uat�o'5�cc��m�������v��/{��̀|�)�1}�6�9��u����yu��w�-�_dl��mh�ag���? � ���e!l��ƴ�z*x��]by �կ��5ގٜr��]�c�e^�*�o�d����7���{���գ��y�ӵe���־���;'� uc��z��2�=��k�bg��>�vk��y��v)��'�y�nf�c� ��w9o/q���y���*���rl�3ΰlݕ��9�ێ�w>��e� 9` �q�%����;����h.�3 ��gc�x�������;��fޮk�sf1�t�s-i}��.}{�7�c>i.�)��"j���m�>c����g6�u�?z�=����uba�hi7��xw�epƹ3��=��?�r��"y�rv��3o�!�m&�yub���6]o�l��ψ��k�o߼�fi}ټ��;�y�;&�c�6'�%�9���ek��� �f2��ʢ a'�z��uz��j�<�����7#�խ2ގ�;��:�14�aᜀ�l?��ۅ� �n&[z��e8�v9�a���/0so��l�����;�$��pwwð�o���2�wi�-�g��%���,x��׌l#d|�2���?��y�lkuf���5�^��@otᕄ0����!��v�lzoc��t|d[^0ds�؜^��wi������(�y��cto����h�z�n6]l�~����$�o��c��֢��kd���e����ۣ/�����)"��~u5z��[���-���է��q������l��1����g]ë�< �� pv�xf�l�mcrm�?ƕe��agz��xe��_�w�k��4���q$��iaui⿎<�k�����=��qm8 ΄�\��{�#����x �2����mm҃���ǭ��}[ޞ ߳�7���b�� k�����6�ֆo�� ��o�7��� ��yx�.\=-���i[ i��= ���vap@�߲\��g�2���㘦sd��q )�/h��/�`ރ�z�p�vef�2��� 2��pso�ؖ���}mfvt6i�r��m��3�% e�w`�����{��}$�cr�&�-s���z�h�ޮc����v���""��rb3 � ���� ioݱ�;��~.�or��%e[�7�o�n==�vb�fy��v�����eէcu sx��z����2&o�i�եj1 ��$p�t��{v���xʚ���6d޹�n�c�?{���{�����jk���2e��t����|zkg���a&�1���q�[����7n�އ"8��,8��x� o��k���dr�?̵6���.�[�����g�t[9��>tڭa�kz[h�3i0����k����w�i�n"��됍˳�ޑ֔��n]�ŕ���7�(��������ml2� " 0���5x��`�s�l�t�p�֩� "��������f�b���:缿�z˿����3f_�s`l [��c���{�0��ߪɼ�)�tƅtщn��a��5� wj�21&�9�l����< �f?x��vrd[4�_z k�t�2w6uofr��?��� �i��u��x;w;�|����a�r���x�~s[x��1���9' �-��?ʴv���m��&��s�^𷿰d��)yj� ޅ�ײ�if�͝�ҙ(pr�������8�g����� �|6砵 �<1�jw��ۼ��c�t>5x�)��/s�d�5�������)�*?�nst���-��'�<ƿѿ s4�?d�~�_�y�f�0s�l�� ��t� ��œ*�a��ew�}�y3–�hf.���4��so��:zj��1v�kj���g�}7�֬�}�m!-b16�v� v�vf������=#�iamp�cf���&w���dc���/�=�_���p�������m uw2*�"� ,z_0|�n�?(c�;ðrg�b�i��1-~j��� �%r� ����0y��kc���ekil.�'s¸,����:�����0��� r������x��,����:7?�ǣj����!gi�u��kh2uð�(]��d���t�s�7{�^���m z� ��osg����asq������� 0ա��_q�j�=�j?��~������u�m�]��̛ͻqu�\f�א:@����1%�b{�?�����2k�f��<�m����s<����<��t��t�ue���v����픢�[email protected]��g���[email protected]�"zĭ۬���e��tɖ|�r�~%e� �/�(����pҕm�'�@]!���z]y�e��v,n�i焊����p���}@�� �}ωܯ�֤n�`tp���j)��54vgc�v�y�3�<�s��z�`� �0&�u�tnp�υ���`���o�d=���xd��)�6��͉00��t9����j�j��v�;bk�od潢tе$�aet6�}�6u������q��,@��u"w&r�x���b^������c`����yn%�4�� l8���r�t�� (* �q� �~��o o��ߧ�~,�}��w�y��#a 輯ލ�fwo% ���s� lp��(!xj5� �s���t�� px�m�'�beo����/�ӭsg��1(q }�7�u8�<���$&&m��� ����~�n� n����!6g� do�}�z��<��<�ǩ��8\�tub��t 79sݼ~����*&q�����˽���g������k"��ӆ���4�d�/�yij�ܛl���]��wh���>��]�hw/�eqt(��$�.� ��4��{@�/��b_�w���3%�yå�#�u zϱ��ȼ��h�h��~d#�^��zt����w�������<��۱��� �;�[3����ϡ�l�do n�����)�.`��9ɍ�ҝ��34�� i�.-9��d����}� (�t�d�����u�^o��� �jb�t��y��,���3`/ g���:ѵ�&����`�����_���p @�o��s���)�ʔ˵�o�r�]�s��`������/w�0�c�|sy��$�(�q���̓˥1ƍia,��9�tj��e��,�^��x�|,��.� n. w��:����'$]*�f�v�ckhm��p���y�l��gι"������2m���2l���s�rd/��l���l�s�r������p�ơ�<۫�trl� c���1��o�¯m�dt��stq���2zd�����t;*�ht��;�x��f��\�k�k(myv^����ټ�����������pl.����y�dÿ �m(o����?��,�� ��`�g`���7�vy�������v�� ���y�awi��a)t" o ������vֹ�[g�9!�y�5-���>oo�����@�k��2� ��@�c��yj�sg��3tg���y� a�۩�4�߮���i�o� �q�t'��{�v���a��(�fw �u�����b�� �}0=���z��g��se_�������ӹ?��sek�t>c�&g���� ޾���v?�5�zdz�ǵp��a�cޮ�f��x{z��b��j�ߞj;(����b�3�n��if�qo�8��y� �a��=j�yp�c�s�m��}$��u3���/��)��ࢿ��9�{���u�b�ʠw���!�yo�fx��ƚ�g�=�$���u�b��@�-!�����yj��������۲�#2��x���򴲆�v��~���̮��3�jlg�7�ˤ\����۱�l��������|o� ��j/���x0a�#�9��s��u�۹z76�ۉ�!�$o��i����;[�s�=eܱҟʍ�»�ob��[����ޮ���� m!��o�ݼz��܀�0�� ��b�o�gyaawfi����lub�nގ5���k�t�׼�he�����r)oέg��<����5o���ϊ�y)�ph���=��h�=�v����[email protected]����e�^4����@l�r�y;���w��2{ �i�lp��o��� ���\���s�!}���ʺ�ӽ������qֹ� �7wx� ŭ�¸e��t�x�k*ю�\ϧ`sj��9yzgrw��o�l�����c�d�y{ "�������o��f�1=*�>^��a� �� ]��:5��st�ǩ�q?��ua ]g ,����x�pi�k��5g ax�=���[���%қ����8�q�&�c��� v���ɉ� ^��g~���h( å�|�o���,e�rc�s�=�a������6������֔=\]����e�@�}����#�>(�#����g2馈�e#x��r� �k��ǀv�;�� =�<0�ƣs�c�����u�w�v������,:�k�8�dkll �"} �of(�k�0�/4��b>'�����^)���>����\n_���:8�ktqtyd�rf��t�&�i���>wys$�(�q{2�nd�'���0�az`ao �ڈv�����7�h�?�� �(��a�y(>d�)��g��ȟ���*����<]x7�x(����� ��/�z����8 �d�l�cyt��g g z��w�� j)& �}���v�#��t � t��k(��'�� �o��s1k�f��;�:㱵��w8},��|/�qu�pqb�3�ߜ�s^�c��ϥf�y��dmke�����uw�c��;��<@���=f�}��q�=lj�f�����v�5���<�!o/dm�u�?/����hg�l�sc��:�n���[hm��3ry���#���n"��-�x�>�j�7�s��o�=aܿr�cy1�3�s��~c ��ł�ѥ"q���� ]mɠnwh�m1�x$�:�?n��eg�����]h� f��1x:h�4)��3��߮�m߃��tsnn�t>�jtr��a.�p��-h�c���xao��lamdֱ�}��[�f�=v���eԓ��*���`�����g �&))`��meu���_˜e�ag������{7x�w�.*�|h]lͮ�f�� ��kh��d"������ok�.��@��/1s�1���>)�i���s]�{u�jv�r/e$.�gsr�@��tyq�t��� ���ݵ$8�:���a��h�8(�7)����%�qȳ �fj�*��">�u'#���?�0��3����_g0rq���m�֠�ͳ*�t9xh���9��j�{w��j���s,�ud�r �s��Ԫ�izǡv�l��]�og�za��]j~h;�z�\ҙ,{ceg"w�r{�f_ �ζ{� ��z�\���:�1�μ�i8o���۞7!qb�(�j-�tl�l�݈������9���r���� %����������)���!��_&stwm�m���,o��=!�/ �b�}� �\l���3��}��.��,~z�f�-������ȣ�������!�o4bӽ]�?m9i# �c�� �-��~�4o? �ˬ|oo�c*wn�˼%p�� ky,��-���#��y�eky����sd�gekx�"{�ް�`��� .��s�3�8 9��xtn�����܃�}�h��e x����v��k���g��^�ӵ;v�ƣ`����[dz�6��� ����(x�yyw�����tn�ƚ�p�y�.�k�x� ���0�h\�e�y|��g*>!���ڼ$"瘀�����0ea���¹�3�u���g�xb���2,��e��t��z�3��>e��d����=��c��w�j�>�/m: o����|��ދ[� �83���r�s&>a�c)��6o/y�m��_�����s�[s�}k�v�ގќ�����x�m7ƃ �0�_˗x;w~t�7(���ľ�:' ��36r���r������ߎ���y��v k�rf�;_�s�=yu��lkpj��(�%�n5o���~�n���jޞ�3����f l��o/�ep���2m\�$s��9)9{짵~�����enm�(��o�y�]�����e°syh��e�ax��h�,���z�s?o�/�%(6�_��֒�!`���{-5o���29�u�{�x�}�(� �#x^�a��^ ]�����9�ݿp�=��ɯ��?l��\.�i�b�������xwy�je��k�i�bן�;�ut� �3g1�/�� �����k��ag�e̩��i�/�͒�;�8p����(��,�u�'oo�kg�k"=����η0d7ҧ�;/�yd��8q>`�gu�uk�9���*�5o�mail protected]����x��v�96����ºvg�u�� �}%��ŏ�b!���t �v:��p��2o��ʀ�cy|`r������o�]k�:�b�}e{�������2١ɛ7gy�=���8��/����0o�y3̞��ֹֆ���1�f���r��' "�6���p�jq�j������z)\&j��e�elevj�.�r~*�� f�����}$w�0�(���y�uz���kt�uv�o�l���oix ro�, ��α�z.�k�~/��[^ f.�[email protected]&m9�*����z�̦�dܙ躓]g9�nq�pu��l��!�&#ܛ��o���#?��#q���<�y��`y�{��?���]g6&��x����j����c=��,{�%�*��a�4���#q�p�]blsw>t��e,��6�gx�|�h�l�ќԑg� �r�v�6 ���j�er�jj-gޤ�\y�{kq��?���å��5��s*�t4o�!w�o�_9trir�뜨it�k��ĝujmrg��s�;v9ghxqt���͚~����f��1��^�� /]�q�r��e*o��f�~�3�3[�9���3��a��8����su���î�e���s�((��h��/���p< �\m��z�b�i�%鏇�&�dq ɉȉb�j���j*�_����;n�u-����⥡z^\$��hu�y;�ڠ�tcގ]�j5a*��v���b�s#h�����;۳ �8� {����wx�p� %�n3p�;�cg*��jtt6�xɛ/����3/@�zs��rp��ݒg�xp�سԙf��9�*�u?'�m�kj��#ucy;�ågt���y��$r�1�u�(y!�r=� cn��h�%���9if��a�wy�b4�@�ɗ�8�?���y2 ��g&�׫��;��kb�2�#�[5 5�.��r�rt��,i�. ��.��c`�a���y� �3,�tx"5�׼]y8�����[email protected]]�ȑ���eń���v�����=��k�$ߠ�v����k��h :w�}��g�=v�����4zb�;�rc�*�xer�e�_���a%,�tv�埼��}�%�'��8�f_��)�#��.s�de/t�\���1[email protected]����zx���tr���(ow �(��!��y;߹p�k��y��^?�h�b��b��m�� 2���o�v�rk�~��k��px��s�hϲ�[email protected];����5���sd�)��ҟ��<󖈹��k�}*c(apq� �t���i��g��t9le�a ����������5s��zf���� ) o�u.�̓�q0�8��=�� ��y���5���5o��>�7>#���ӯ{&�so2s�2�t�_��/�v��� �m���Ÿy��ȸ�cq?w��|�=��w9�@ޮe��휩q��"���_�8��`.gbw12�%�]^�&{��,�x�v,f� �c�c�!��{�0��`[�����o�6k���}*qf��t�/��sq���dpp�v�ʸ�z�m��x�\�m �v��/j8�0'<��:�ks����?a��ž�� @�a�o�i�oy{��%:y�����5nu�ej�)�ϧ���� n��^se�z-o�������[email protected]�s�x� �w�p�o����ye��p���u�?f����5����v�`�w�����%��s���ⱦ�5χ�j��s]{5or��y�� �6��uo�hm2�탾ҿ�� ��yl����y͜ӆ���\v?e�%��i�s4o'x���ۇ�,�u�vh�-�u.��f�f�:�:� �tf��.��g��u�vm{f�./������5:�֔cŕwn])���3�v� n��qkg%�{�t/i�c�#us�횷��q��oga�᥼@�v�8�̒�^0�8ę�h,������[email protected]�h�k�}�3�o!���������/v�w8����� {��3(��{�t�o�x�*��u�d�_�۳w�� �e3��=v���\ ��?�vf��|�z���4� hv���s���:s���������$^��g%7*���q(�lo8c��o/5������a��l�]@��^���x�]8��lb����=g. �h�(}3p �zp�q�3���]�z�6���5j(y�%@=>l�{���ts#ݾ�x�?�xxw���'�� �6ޮf�#/���z��]�v?.���8y'z�b��d�s$� h�na�pew�6e�f0�-?�=m�kike�cf�e�k��� eg=ot��,dee�:��e��2�7e1�ȝ�d�7�i�m�.�bw�b?��н4�� nt�㉽\x�1u���=wbp��_{�m�r�>:���ե�s�i � ��.a&р�o��e�۞y�c� �����w��_h�/9�v��e�'���rt�p�5�$�g����t]z<#eft�ooe�oo$�w��os�{v $��!fm/��~��w��,0��?,��l ���� /��b�,&撬��օ�� � g]t� �6jva 7jk��t|��xrbʠq��������tɓ��e�u�go� �#�kq�9a? a ��u4�����]����o��ibfލ�x�:�e�{�jܣ����xb�bi���?�>ʴ��� &1fy=�����غ�ڗ"�rغ���d����y~�"��!���v�s>%)����vd��n�~��2��쓑��z�u�6��v4�#�p�)���v�rm��k��_-��#��n���rh/��rn̖�4���rso�vy� ˟f޽и�unw�';�jஷ����gr�djf�� ���;�ۥ(&ز���ͽ,��3���y�3�xdn��9�m����m3������#zs���pp厔u�(��׻�g;�j����и�wi�hk�={�o�y�fi͗�lj/u��v���]��g}�>��ujn4/��?�� ��j�!��!�f*[q��*�g,�,��ik-m�f�rϟςeֻ ���ch8 �b��d5��i_��j]����z����xh�t���x�f�u%ߺ�5>i�_e�6�p�dqq�o^�c1p�ft�������$zȍ��f#[email protected]}� <'��̺�n�̥��;si{�$�duo������t�&�li�g����n&�:��˕� �2d�=f�}]���qk�z�\� �~g\���]뎚�c�pցn������@j�n�hˡ���ss�hmt�v>qщ fξ2���_8�2����4�" .wܓ]�x�y�9g����@<� �ϼh��ƚ_l����h���r�7 �.crx���׺�m�ȷ�&��b�n�?`� ��=�e&h��:<����r}mu7�q�v���yp6�j�qvɍe�ix>�{�bd,%�sy�|)2qu�jq2z�� � p��(�r�iy�{#�㧺t��@5�^֮�_#�~۸:���վ��q����>����㬔�a�j�i�9�]���ɴ-�l:��l�] %!�n��@o�q����\h�aޞz�fg�� h�v9�#������~�j owb�pl=]&)��:wz�lj}5�7"s#2�d�w<��7bh��d�`"g���*����3p�g�|j8��1�u�]�*y��;w��jb���3�y�u�-��u�ek�a�oj�zow����#��>��v��lf��p�8k>�3c�0��w�獲 ��%����/4���:��ն�v>���p$��oz�5�����hs:`y<�d�e��n�l̙ԝc�n.d�l�^`�3�=.`c*z(1�q5d�$w�o������; rxf���%����g�� �s�k\h�4z(x��%��v o�li��hdz�ũ�aʇ���]�h5��02��˟^̽���w�^�ƣ u���mgg��(�k��~(�{e����i޻]ʒh�/"n����x;/��ɉ��ռ��� n�<5h�q�y��u��y���ͼ�6)bz��ri���q]��u���?գ�z�c���k���(z���.�}l�9��vο��������7���c{��w�h�yd.k�p‚\!m�� �b��o�gĭgփ�o�j>�h����o��^[��ŏ���w���q$�i���~n�ȟ�� gf���������g�o��y0��-�m���1=����[3����]u�w��v�ؚ�)�i�ròķ��y;���y�ۤ�ü=�,�<�����]~�ꝶީ��j��[�=�a\v��ძ��]7���n:δ�����ҷ�fp���*g*��o��֣���砏����n5;��������f��n� cs�`8t���s���/�iq�d�����q�kk�w{�����cu�h;i ����y����큵5%?��bҧk�g�:4�����n���=1�_\}��$b�� ���vx{iw������8eb0�|��-����h�3���{�կ��4�k�v(h�. 3�e(t�= -��[�?e�.ta���z��z����e�ou�<�[�g�5eo�3��]��e� ����墱���m�4�*��a[?�շz񍩟qߨ#��i g�w����rd�����'͢���;#j��;�z׿�����̿k���p�>h�{\b}h*,][$]5۽�6*�n��slp�p���7�=��gj񍞥��a���6w�j;��l� ��[�?��kh@�czx{�����c���%��^�z j�6�ؾ����, ��"k{&`,�z� y����o�h��3%*@l���:�\ڥ{��ڏ�i��%��$�|�dib��%�eν�c�m�|:���`_�y��c�3jv��-og��i���=��u�/��{��q�6�*�q\�dn�α-��[��� i�� �k�8��mail protected]_�̛��.� �o���� �^������8n?���k2��y&�z0��9�⺜��o(0��힜*� ��`�{��y�{vy}�b�sb ϯ�g7]�����qnc�p��r���1��"�m��^��� ��n�ѯw���-���]����m߇�u��9� ��)�5���aw|(��u��z��$�� �!jύ�>e��m�d�ǝ��ξ�u�i��,uoj�;�jh_�v`����~�*���{���)����6�������v ��t�������k�?�����y��c�ۍ�/�ۉ����9�o��ԛоv�o�9�jir�pt����#]؁ c� ����o�b���‷w����i'5�~�$p�iwv�/����i?͛acy{���4u�qntz�^�?�~ϙ]�{ib���������b�jr�i��h��8)�/g�!u� ޞ��o3�s�x����i�as&�xa�6�����uh��.9��`δޑ(�x��ƨ�����ww;�͖�j�[�yp$�k�z��;l�q%5j���%�j���hv�~�7�.]���t�̞�ʋa�-^o��ֱu θ��� d둀k��u��my^s�� #y��u:̂hh������]�yyr���ޡĩ�q�m8�02�s��0��vȿu޾>o�w�ku���i:qߢcwi�-����ڊ��f[�~t2�ř��$��l8��^"ιfs�7 e��tv�� l����7���v>�*1-<������h�s�ҩ��7����#3������'��-� |�t��<���fboěf�ɭ ���h��5����4�y� ��܆�c�g���]e������y�i1lk�iolj1�җ{%���-n���_����آ�7~p�t�� �2�r�֝ v#d�� ^���uoh�����9�cþ�l�j?�8zvb�h�f� '�@9s�>s�i���'ɩb��9c9�� z��큸;��.��uy{_���b�)�l�u��4���h�� ��:����wc�����vi>��k2�� �c��p����k�o:[�� ��i���[���r� 'u�冕����)���49cfl7r�g�bl�<���"ᢞ ��ƣ�,� /���t����&⻈�c|�a��u��h�:d�i�!�2龏�{���^�(�՗t��-h [�$"�ҷi�'�t��0d�j�g����� ��ct 0x�#/�cs|ŭ���j�ެ�n_���@(ډ�4�klw���|��)�����rb�4�u�������@�[email protected]*���y �x�:nrr��qň��ܶ:��g=to��"�nd,"]����e�jvրyk��dh�qcq���~�#�c�p�sp�gtl����j��:�d\�l0�6sί��*3� �,��ē��g�m��������˃��k��q���y;u8�^o�)t�������u=����[email protected]�t�l��w�x{sҿa���o�vto���r�d.����=��"���5i�~r`���n���s��ל����ԧ��g��f;�;꒜o�:�5j�ma��ӿn�9�^_xu�1 ~t������x�|aрv� li��4�oj�����l���h����i��*�]2ԉy�_0d�r��0p�j���0 �di�l��k�t����a_��9�ksr����n�� *��d�ɏ�h)�ƣvh��t- ��$�p� mz���?x��1)e��k����q��?:f�.cy.#6����x�̢���8e�e�o��=<`\c��lj"�1�f��v�faa�,e�^�kߊ����y�!�&s4 ��y��؅�u�t����ah%6��ǵ��s�e}|z��1w�zi�8�kv���0�뒢� ���؞�#��ox��p��.o׍$=�(�j^�:�\�w�4��6��h�v��l7[�'�%��y; *� ˾s��d�5�|l��ði��>)�[email protected](��?r2��go0��<������h�b�� �kv���ë�h#:_��d��[email protected]۩*�jq�pf�l߁ �,@bw�fh����gc*�vw���bސ#��rio��c!fws���mk�w�^�ʻ�|ࠬ �hl1�d�/�w��i�b/׋#\{y�����6t�m� �*� r� ء���\ ����8b����xq��}�xi{�\�ulo�v.̧k�0v�х�ԅ��� �)���@dž�-_������kn�ۡ\�0���f�f�lh�e50uc�����v� 샐px�pq�titj�q?\����b�x��� o�*f�tȫ�<������1ny!�)��2``e�}���l���a�={˻z���)���cok���b�^c.��3�p`� �m�ռ���_}b�wx���ΐ�sx��x{�}k�\s�x{=~�.�a��< z|�`�.�f�ۯ�`�;��g�v�!>@.��������0t��wwi�pځ.l�pގ��vv�i�)�à��b��%�]ȇ��> stream adobe photoshop cs6 (windows) 2019-07-11t22:45:25 2019-10-09t11:26:01 05:30 2019-10-09t11:26:01 05:30 xmp.iid:1d2ac23d-ee61-442e-857a-5040ac177e91 adobe:docid:photoshop:e270ee87-2ae7-117d-90c7-d15dc1f2b7b0 uuid:faf5bdd5-ba3d-11da-ad31-d33d75182f1b saved xmp.iid:b89a26c0-621e-4f2e-996d-66b307a29663 2019-10-09t11:26:01 05:30 adobe photoshop cc 2015 (macintosh) / converted from image/tiff to image/epsf derived converted from image/tiff to image/epsf saved xmp.iid:1d2ac23d-ee61-442e-857a-5040ac177e91 2019-10-09t11:26:01 05:30 adobe photoshop cc 2015 (macintosh) / xmp.iid:b89a26c0-621e-4f2e-996d-66b307a29663 uuid:faf5bdd5-ba3d-11da-ad31-d33d75182f1b uuid:faf5bdd5-ba3d-11da-ad31-d33d75182f1b image/epsf 3 2019-07-11t22:45:25 endstream endobj 10 0 obj << /type /annot /subtype /link /c [ 0 1 1 ] /rect [ 172.8 312.735 295.246 319.898 ] /border [ 0 0 0 ] /a << /s /uri /uri (https://docs.wixstatic.com/ugd/4344b0_813b241e8944497e99b9c45b163b76bd.pdf) >> /h /i >> endobj 11 0 obj << /type /annot /subtype /link /c [ 0 1 1 ] /rect [ 66.141 301.235 259.185 308.398 ] /border [ 0 0 0 ] /a << /s /uri /uri (https://docs.wixstatic.com/ugd/4344b0_813b241e8944497e99b9c45b163b76bd.pdf) >> /h /i >> endobj 12 0 obj << /type /annot /subtype /link /c [ 0 1 1 ] /rect [ 365.589 174.189 546.291 181.352 ] /border [ 0 0 0 ] /a << /s /uri /uri (http://www.microread.com/upload/201908/26/201908261529008465.pdf) >> /h /i >> endobj 13 0 obj << /type /annot /subtype /link /c [ 0 1 1 ] /rect [ 317.205 162.689 415.758 169.852 ] /border [ 0 0 0 ] /a << /s /uri /uri (http://www.microread.com/upload/201908/26/201908261529008465.pdf) >> /h /i >> endobj 14 0 obj << /type /annot /subtype /link /c [ 0 1 1 ] /rect [ 378.225 116.904 546.3 124.067 ] /border [ 0 0 0 ] /a << /s /uri /uri (http://www.microread.com/upload/201908/26/201908261527082527.pdf) >> /h /i >> endobj 15 0 obj << /type /annot /subtype /link /c [ 0 1 1 ] /rect [ 317.205 105.404 428.385 112.567 ] /border [ 0 0 0 ] /a << /s /uri /uri (http://www.microread.com/upload/201908/26/201908261527082527.pdf) >> /h /i >> endobj 16 0 obj << /type /page /contents 17 0 r /resources << /extgstate << /gs8 80 0 r /gs3 51 0 r /gs2 82 0 r /gs4 81 0 r >> /colorspace << /cs1 83 0 r >> /procset [ /pdf /text /imagec /imageb /imagei ] /font << /f8 87 0 r /f1 106 0 r /f3 109 0 r /f7 114 0 r /f10 119 0 r /f2 128 0 r >> /xobject << /im2 18 0 r >> >> /mediabox [ 0 0 595.276 793.701 ] /parent 61 0 r /rotate 0 /thumb 65 0 r /cropbox [ 0 0 595.276 793.701 ] >> endobj 17 0 obj << /length 3917 /filter /flatedecode >> stream x��zi����ϯ�)t !� �q��(�r�5� ��@c�[email protected]�г{�r�dn�7�;yk7�e��m�j{}���^|�an�>�ɬ��nv_}qs�nnګo�dln>]e���$����]b��d*klj&7˫�eo�o�ռiˮ��on�t�&i�f��zz-���d��&�ؘdg"�i"#w=��s���mh�h'�ނiv�y�ns�l"r��� �"v�&6�w kmji ί ����tr��� 2� o���v���$˭���c,��qo���7k�?��=~���x$~�����f��im��x⛛���tl�i�剴a�z�d�|2[^�x������7x0��� <�:u������~��*mdt�h��5�����8 m�ջ�����<ǧ�j^�d5����v�0����>��$y�����}�˙h�,����,u>���ĺ��e����[email protected]0p!��e�� f�b����"�y̆�w�% �����%jk�h��%����/cpj8 �(��`�/�z� ���c%'�e(9��,�t0�)-��:8،t|���'��=n%��u޽fv�j@javų)z����&�$��y��>f/c�]��gg�|���a��i_bǿ� ����;�64�l�~�'?~d���&���$��cș7 �� 8槦�>��������g�΢��{;n���e� ��z�rq��ð���fe= }`8- �os� s]w=x�6���,�o�~g�m,�9�e� �)��o�3t�j��`�a� )6w�5�mѣi!����fy��b'��^� � �.#�r�%j�e}�d*5�z�*r��kt�8]�j�9��᪨j<����3�w��]�p�dތ� �:z�,�f-����g�,���m�t�hrg��2�*w.##t��v�w��p5�5�ьq��b��ua�� �i��ghpd ���=�!�̾m���砵�y�fi�,�^~�>�m�p�t�\p��w�}5�n�g��^b:^]�����&��{s�<�$ُ�et3:k�/�pe�ܷœfa��_hd?� mk����$����{zsjt0� ��t�h$%ئ�ox �֟l�[email protected]\%`@�o�]o�dp#�q2�����|�w�no r^ �d_d=pm`xwuyh.�s����w�n&r��0 gu�|=n� &ll[^c#��n�(��{{��f�c^��y����q��bwc/�o"�� �zt�!��*s�"��t�ɰu�6�h��|e�[�j�3�t� ��[tg��g�h�ǖ�al7pt��&�ʺ��m1��w� ì�>g��x�\ad$���x�$��a�k�,�1� ��wd*o(h�u]�ssk�0n|�g xg"��{v�k�}�q�al5���>�i�rt�?�eݱ�*�� f=��5)��� sϼq�3�4�r�]���dai��o�[��ldzjρa5јez̊�w!����2ȣ@ &3v���_�ւ�]���̴�-�������]�4.?���u�\)!��=�� $���i�����bk}�6����il�: ��t|3����qf�w��{�o�� '}��2ǣ��k �?g׼����@�e����h�f����jb��� 5�mt��|��w֦xd~�(�{��6� f��1d7�rj�j�l�cld�j��sn0 �9q ��xjfg���bj���-�sd���,��a�b�� ��r�ɥ:��x����\��ʿ�-�f�!,��(7(����ʿ���s�6��f3�]�9nsu� k<���1�\�bh�@�iqr���;b�i;�<7�>i������]bqfk�:p�ˢi� $��z{ni����5%��w���!ӈ�t6�@���l�b$�c�h��'��>�[lċ��qnu���m�h觯va��w�b`aue�3d��i=��� ��ǘ� �u�@�%w��� ,c"�w�������i t*��z�v��=� g�� w�ś ]��0ӭ��k[az=�n��s �����ҭ9o* jb�r����"e>ဳ8,��8��*#��4c�k�kf�qe��@� ��=м�����s�b����p����#�f%;������v�� y(�v���x�}�v�ⵯ)ⷍf󢾧j?#��:�a����h�(�j{�3t���n��b��8tw�ґ\��6x'�r��k�m9k���ɥ|����=ۿ`�*h uj�v *m��8���}��y�աn=��h�cq���h�&h��$9�6��~oݝf]vjwv�<� >���y�{�x|�2jv� j�̻�"t�ryt51ؤ\c�q�5㉢n�9s�٢fb,�r)b]�`]�rŋ �}_=�}�*p(������m��mc,��y�i����a0��4) ~��t�-i�@hi�~��tʼn�o�1j�@.��"��g��3;ryat�j�fsm�# f�9��ռl �|�gw�b�ˠ8eo��j�cd:�;?y(h ���0�"�r��r��j�g{��eg{g��`$�������<� ��y*_�o����o�(���;fe�fbi5x�m �!��f�� �f�b�l��'1?�j-]�.�z���a���^���㾜ҡk>i6��p���!��}�v�r� ��#�ʽ�4��j��� o��2t�����<�y,.���5�lm�u��Ꞹr��u}�^rw2�a�1���j��7�fz.�s��#��)�fx��w���l^���iu��>���ؒ��� ��~x�����ӟ�'�4� 1��nu�a8u2g�;�4��/ bng�� �%kfݷ�&pt{���f�c��as� ^є-���8 ��?nυkyvj��̚[����wf����x�h �!nd��cz�� 7��#��y7�6]7�kć�� v3��<�9*9;�^of ��!��n� ��y�y�h=�7g|ů�d1g���a�α��t���?��oc p.� �xaб_�s�\sx b� io�|�,j�aэ\�* ���e�܅v0�kzdcs�� ���h#` �ଡ��@p��p[�����of�" s8e�i��m٭Œ���9��2�ܩp*ƈ|�?}0�n!(9�y�������r��ӑo�7�ǡ���c� �d�t�p\����wo�:���$�����g�f:�>���j����oc%@���9��x3 k�� �p��d��@́����luc�^䏽�m�v��r��ąg���ę�g�v��k����@@�,�8{ss������� endstream endobj 18 0 obj << /type /xobject /subtype /image /colorspace /devicergb /filter /dctdecode /metadata 19 0 r /bitspercomponent 8 /length 297077 /height 1243 /width 2001 >> stream ����adobed����      ""�������  s!1aqa"q�2���b#�r��3b�$r���s���cs�5d'���6tdt���&� ��ef��v�u(�������eu��������fv��������7gwgw��������8hxhx��������)9iyiy��������*:jzjz��������m!1aqa"q��2������#brbr�3$4c��s%�c��s�5�d�t� &6e'dtu7��()��󄔤�����eu��������fvfv��������gwgw��������8hxhx��������9iyiy��������*:jzjz���������� ?��;�z�ӣ�� c$ƽ�4޻6*��|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����w�|��������w��̟�_����tu�����2[��2�bha������?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���w~����y���k�]�o���g����w�?9��5���uߤ���,�y���v�iy��y�>��5�c�ic��~i�劧���>��s���==9=6�g�9ߏ%���=7�b�~���,��<��[��4h��5ȋ�?�� �⸫ь�[[��"[nqx7�h�c�እ��ֵ��"�h-��t�f %נ�:�⨏9���ʺt���uc� ����tr�=����u���6���bn�y}1���h ���g���wq��]�x�w�>�u�g���wq��]�x�w�>�u�g���wq��]�x�w�>�u�g���wq��]�x�w�>�u�g���wq��]�x�w�>�up e��*������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������ȿ&�lu�~i��t~�{��:�մ[��:�u6q��pf�yw��q��k~z�h� �h�w��y�"8�d�//�2w��b�a��^p�#o����i�/h�9��w�o���z����ڙt�{u�,�'.t��z��]e�e�噯��o(ٙhъ���q�yoӯ�ż �/z0�s�uث�wb��]��v*�uث�wb��]��v*�uث�wb����x��*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]����o�?�#��u븫x��wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uت�����*���v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb�-�����-?."���qw�}_���]��w��� u�w��1w}_���]��w��� u�w��1w}_���]�s�b������w}_��ث���~�u�w�?v*����w���݊������]�s�b������w}_��ث���~�u�w�?v*����w���݊������]�s�b��d's�zb�^��)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzm�~�uޛx�w����]鷁��wzm�~�uޛx�w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzm�~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛx�w����]鷁��wzm�~�uޛx�w����]鷁��wzm�~�uޛx�w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w���~�uޛ�)��wzo����]��w����]鷁��wzm�~�uޛx�w����]鷁��wzm�~�uޛx�w����]鷁��wzm�~�uޛx�w����]鷁��wzm�~�uޛx�w����]鷁��wzm�~�uޛx�y����s�1w���]��v*�uث�w��x���v���f��qeipbh᷉�(^e���㚍f�p��_���z����džm~��1�;������ڬz������f����ъ��*��,$ x8�տ�q�ksc��x8���������%��#js�%���-��t��y��xy���nmnx }���&��0�uy�a�k)�ig�4�%�maa��tdp�2�@d^����i���lj�c���l���7|˧ &}e�me����btv��tx�!��>-���mx�k>n*0u�3��y�o�e��֭�;������ ��g$`2(��o�sc�dxe˽<�;���/�#e�4f/�ܻ��������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� ������ӿw�����4_�f?�r� �������߾�?�/���ܻ���)�4=�_�z���k.�0����x�@��u;|*χo]����|\q����v*�uث�o�_�_0���b��[ϫ[��nvpw. ��6|�f���t��9c |>��$6����z�k��mun��)�` v�����˯ˌ th=c���y�dj�(ˬp�_���f�y�u�>\�����py�y�>����ghf��pk� ��x>��(�o�w m<��\5��jӱ�>����=6�����=@y��_%]_���uԗsj�i�ʖ��/ӑ�_�#�u�$d�����i�-n�,d����y��e����^[��dk�=5��hz9��� ��͚�@��7h��_ b8y�ܷ��~f���i>�%��3)hma%p~�uf�pkr�@d ��ӧ������u>iޓ�?7����y��j9)��_�fb��l��c(�,ݻ��ea�w���z_�f��h���������w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]�����w���z_�f��h��n]���������km-��t�ј�e�w�2p�h�][1�a9h ��yku��4 ]f�\kl�;,v��m�k�s�?<|���>�4�w\�#��cx�f�z��"8dbkw���-�ǀf�_ث燘n�v:̈�i�<&�t=h�is��ί7�gqwқn�p&1�w��[email protected]���6������{m�{xc(�y)�*ͯˊ��ȇ���� x����(}��:խ������yh�z��z)����3b���ʛ3��� ��>@~�=�矙o%��� �t�$a,��c����u� �i��ݞmnx d�>���g^~oy��x�˧zg���[bu g���o���)�:��v�2�� �� �w�d��/�$ "�l����1?�d�~�� �>������!� c�0i��n}��|�i����g�z�ly��,y���٠g�(��������<�k��/8f�"���f��c��j�҆1�g&�f��%��!�� ǔ��a���59�[��inb���s�ӿcju�b *1�y�y��q���s=�(����f�u�;��e�a��(vd�'!���[�]�$v5$��|�lty����]�yp��p�^�s�x��wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��r�5��*��17�̝7����3g���>��y?�8�?� �@g�ץ�7��ث�wb��]��v*�k]�����\� $��,ǡ��,l�p<�_4 �p9��#|��z��w������:*kj�9���pc�_p��y�ŋ���ۺ��&���a[xvb��x�%h6�<]��. 5�7#y�͇�פn��m~m�=լ�m.$�oʊ�@��c�k ����:k̶��d/���%���姶_*ދ�k�d)k:���f�� r��_��g�kƀ�g(�g��*z��q l�k=^8 �yr�m�a�fo�of쌤�qo�{���9��3߾��ՠ�=n�(t ��qeuz=�\��\�6dk��6d �柪�2�ߖ癓�" g˒퓇df��*��vxm׸����y�dy��s#fj����z��#��c�\�ǰ3f�@_=��-�����˷ ;�4�0��jq=����۹o`f#��wu�����v ϻ�2ș;�_�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋��a�����c����/�����7k���i�j[���]k �o���u81�p=��x��"�����]��|��o-ꩮ�m]b�{�,o�r �q�nh���g� p�o9��ܹ�q��δ��ukd����*�hgp~|w|�ϲ2���˪�ag��;��z���l���w���ai��]�df�� ��ϰ�����*qh��s}f?,l�ּ�*�<�v�#�y��=���ma&{wy��}ɵ��̷3�ny'o��,)��k��df��-��c�y�8d�wy�k�}j����̪����#������r�;4>�� /luk���w��>�a���a�df��*�p�,���׸��y| *�w� � �� �d�����o�e�_�_�b�����l���s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e ��1����w����m܊xd�س��ų��# n;�o&���yv��� n�����n=3�{�|�y_v��[[�.mu$l�;d��"����n��)�bt 戮��9��r��d��!0:^�`��s�u5�k��i���9���~�./������m��ڭ�f����3}�ai��\����~��|�t��it���my�_˷1����09��]��\�ɍ�4��庅�������yfh���hu[~���j]��b���['ؚ����y��-��4�q'�nzh�ø�e�u��dgc���5�������qo�ܲi?�ndx�p�`�>*j�{,v�{4a@_=������y�fc�'xk�c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/����u�|�}e5�z�ip���~��c���o��1�h���?�-���� �q�8#v� ��&�<v*�uث�wb��]��]_ ���\[��~k�.fts`uڠ�%=s���~\� �.���^l� �.|�gy��6)�zyv��^1�q_�\Ÿc噳 }�}��f� }��mm�ڇ�]��hj�# ȟ�e�v>ys�%�`�9�\�yea�xr6~[������ _�� �#4��_���ag��;��t���%��>x�&�<� s�� \���q����]����3ۺ��_6���8���s�����<�r#�3�%�u���=��ҥݾ�y�\�v�^��5���pg��ǔ�c���@{����/��^}�ِ�d�����o�e�_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?�z�b�������"d� ��2:.����v ϻ�1�d���d�t]�����w�w�c����/�������x�>����'x_�9���w��/��^}�ُ�&n��s'��_�_�b�����l����o�e޿����y�f?ș;���̟΋�1պ�����2w��c�?��^��&�g%�z%ⴼ@$l7��#m��1"f���vl9#2g���]>6��$qftpg��=�w��]��v*�uث�wb��]��v*�uث�wb��]������������wb��]��v*�uث�t��g��ݓ�7܊'daws�qj91��r �͝�@g�lmy*�2�d�{wo|��h|�`���sc��n�p�u��sluث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb�}b� >�k˧� �v;��r��kg�b�̩�kms��q�2�co� ��^����͍f�-��d�[�:�b���߰w���q\u�hz�z͔:�)$i:� *�q�˽*��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�j�v�t�n�c���z�����(�f��_�~�����2z��g�_��$�����r����o��|�o �\��9%�ǣ�*��튳,uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb�m_v��-d��qlo���ث�6t��&mn�b� p,���#�?��|u�~l���}�� �mb��"��f'�f��Ϳj�ה����r��h#bw�������xε�ףiv�}ي�q�fd�!�3��e�)�g�� �ytcv;��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�t�� "�w�c��$�l�.g�d��/qlu��2�0_ϧzz�,�i*jv��y�y/�sm���zl7* � ��6*�o�k�*̱wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]���j�u��,�p��qvt�rwnʋqɏ�*�^�m�������^�m��� {$��/ �%�� ���)ኽs�6т�0���\�s ro� u��eث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��r4y~�z� z���l���iq�{b� �<�|��%ob{��%��gmɸ�,���k�o���,og[���2��h��n߷@��� ǎ*�����b�:��z��֦��#��d8��wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��^[�,[���d����n/f�y7'�� �/�*ļ�����k���=�ڄ�ɧȣҏ�f'�)-�������%i�:_����p�o1�s��)'��lmɨ�y����*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb���`���5ʃ<&�apx�sztvs��r���^����}�c}ku�h"x�qgs�5�t�f:�ت� e�-5w̖�m���@\�:raa f�n[s�}�w�~r5�����1,�է�6���=�ύ��y�*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�w�~my�?-}rܟ��v̟[14���� �g��㊰]o�����ڇ�-�'ic!�`�}h���w-� �b�r���m#n������jz�:[�j��ӈj��� ⯥�9��� \zi���9t��q8��wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb�8��l<���y6�ui�$�,4�fe v $�q�v�/�*�y:�kۨ�]����wv�c�,�h-���t�'�⬃�v���u���i"yy!����p��p~�a_|u�x��wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��x��&��~������s�kq�� co�t�lu�v�q� i /��r�s��;��@�r胒h��=�*טt�$����2\if�'���v嚴h�s�"�qw���6�,κ8�>����k��f*�b��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��xߞ�>��e�d��؞7]9�ge`z�ʢ���pv銤�fmoe�bf����'���e��32�e-�;ps'����/��/̑�yf�z��bi<������[���^ኻv*�uث�wb��]��v*�uث�wb��]������������wb��]��i�"�=�*�} �nn�]z�:d�_�n��� �ԋ�1�ڧ|ue��b�iq�z}v����ђop� ��#�n6�n�7���kvv��#�(roph�0��g��p�dm�`7zv�l����qqqq�(�w�g�*�_�j�zv�7��i-mm�i�y�ew,h��j����s!���5������u��c�i�z�*�\uc�j�u�m�e���_�<��wk?���t��c�� ��[email protected]��/���f�,��jo�? gbڥ�����g���*����g/��wg���i�m ���*ܟ�>w�w�-|f_늬����o��y�������濕 ��l��������gyef��z��r����o��y��������lyo����9�*����y` �v����*���~]�//�n.�㳘g�:�pv�צ���n�lys����9�*����xq�u;bu�*��5<�����>e�����[t������_늯��g�������qv����g�ꖀ�̿�[� cʟ�v�����qu�~iy^z��-�/��4ܟ�w�u�[email protected]=�_�ҟ���*����g/������o��y��������lys����9�*��[t������_늻�vǔ���g�#���v���� [ �#���h#gh���*u���u��ߔ�6���������4�x1*zn>x�i� c��u�����qw����]���r�\u��<��wk?���w���*����g/��u��e�k��v��5� m���a��[?��� � cʟ�v�����qut���à˩����������4:��g�\��w���*����g/��w����yk�t�4��*ԟ�~v��}r�y����lys����9�*����bh5[:����*����b�4�u ;�{٣�hre �` )^�~��`��>ue ڭ�$oyv�qu��<��wk?���_旕� r���e���r~i�z3g�-���*��vǖ?��g�#�����t&�u������⪭����s�ū�qu/�[s������_늻�vǖ?��g�#��⪑�hyba�5kb=�_늬�_*��ڭ�#����k�vǖ?��g�#��⭧毕\�]vг��_늯��c��o�z�*�\ud�j�i�'u�$t��\u%�����z��ͤ��c#�й(�)�3���oo�g�!-7�5'�7�����z����o��y�������濕 ��l��������gyef���j�\uk�vǖ?��g�#�������o�������������-����f���i��5��6:����_�����o��y�������~f�e�e��h=�u�����濕��`����(k�vǖ?��g�#�������o��y��������lys����9�*��[t������_늤ֿ�~]�z��^��-��9v�μ]��x��n�lys����9�*��[t������_늪��w�\r]nѓ�j��қ~kyqm�f����↿�lys����9�*���$�s�#�j��x���ubu�[@goy�*�?3|�ef�ko�ʿ�[旕�$&�hh�i�������x�'�-���*��f�e�%��h?�j�\um5|���j���=e����~f�een�j��w���o�n��ٺ�?�r?^)���򅲲.�b���~x�-���u�* �٭l����yt� � �:�銧1~hyv��z��w��v�qu�~h�^!w�-w��r~g�ba�5;b�e!�*�y��˾[������鑑v�v��)� ���4�g���i�������?�iyx���rӟ����x�����ʂͩڀ?��������c�� ��hg���qcr~iyz:�-zve�������*u;z�u������~v��5kb}�_���g��s��-�3/��4��vǖ?��g�#�������]���r�\u��<��wk?���w���*����g/��]� cʟ�v�����qw����]���r�\u��<��wk?���in<�������m4 \�׊2�#žx�u� cʟ�v�����qw����]���r�\u��<��wk?���w���*����g/��]� cʟ�v�����qw����]���r�\uy3<���ڐ��������j�u�m�e�����[t������_늪g���yst�#�u�������g�궀�����lys����9�*����xq�u;b �u��qzk�����6{�nm.��&x�%x���^�,p֑���=b��潲��es �"�i��}�tտ3<���s�ū�qm��;�.�ha���� �|�ˇ�[n])�/��u�;��ϩ�;�w��r�f�e�f�ja��w��6���������⪍����s�u���\se�����s� �ū�qb����r��i˥=e����?3������&u����o��,8亝�����-��s�ў/���2�\uo���*����g/��u#���ă�j��{j��i5���/�w�q��m쬒h'p"p���]�۶*������]���r�\ur?� �*���ү��v�槕c<_u��̿�[� cʟ�v�����qu��h�^]�t�4��*ԟ��v��}v�y����lys����9�*��[t������_늻�vǖ?��g�#�������o��y��������lys����9�*��[t������_늻�vǖ?��g�#�������o��y����������q)�싁@ުv�:�4ߝ�y�]�mk�f�kv����e*h#>�o���u9o�(#mn�3u"t������]���r�\u��<��wk?���w���*����g/��]� cʟ�v�����qw����]���r�\u��<��wk?���w���*����g/��]� cʟ�v�����qw����]���r�\u��<��wk?���w���*����g/��]� cʟ�v�����qw����]���r�\u��_ʇo���9�*��_��˺�wuymh`��:�j��tٱt��vǖ?��g�#��������]l��r�\u�[email protected]�w?�z�*�uث�wb�d t�4j|u�z?�δ����o'k��5��df���2���}8����mg^�m>h��ӵ����j�3q��������*��yy�0�rh ��� ��sl��2����*�����ɨj~a�!ke� am�?�a�<��?qc��-7�s��y���k!$6��\f�$��b��>�#��*�c�= ��8?�z�lu ?�t�j-��5����>t�]c5���5������,pȵ��������i� bk{hcp��p7���/�{ڲ�)��ז���������t51�=>y����,�ɑ�����c��e���js�[i�j�p���b�m���hhkh ?������kh��8?�z�lu��"����c��1�i� _銢�zg����"��b�� i����_銡_˚b�� ��_銠�o�-l���[x�7� yy� q���so��,pȵ���_-�j�v��v��v�ʺk�&����ƿ�_��?����q��ƕm ����b���"լ�'�1���u?�zg����"��b�sy_j��m ����`-�j,ir5��5��f���?����$����,pȵ�����zg����"��b�� i����_銻�%���-�*��|����y5�(��іx�r�n����>�e���"���r�(�n�qtg�kh��8?�z�lu��-#�x���k�1w����c��e���\|����-�*��i�����_�r)<������"��d�w����c��e���p��olf*��?����!<�� �����*��kh��8?�z�luf��tdq��w� _銮���t�v����ƿ�t� i����_銴�s�$y�_�ƿ�iu�"izփ��ak!z�h �qt�<��*�����׷ъ���?����q��8�@ ����[�� �y�o�c_銪�����c��e���zo)iw�pȵ���?-��h?�z�lu��?����w�kh��8?�z�lu?�t�ڋi��*��t�p�g?��*��%���-�*�_*i(�����luj,�n�kh��k�1tg�kh��8?�z�lu(���ѥ� ���kh��fx�ȧq�gc�-� [email protected]�c_銢�zg����"��b�7�� pȵ���?-��h?�z�lu��?����q��,pȵ����9��,�-�aȥh�g����_�q���?����p��zb� i� _�-� /��6pt��k�2m%���,pȵ�����-#�x���k�1w����c��e���]��?����j��,�h5i��e�"h�e�kp)���s_��,pȵ�����zg����"��b�ykkf!m �k�2%�<���zcm�?�z�l�qo�%���-�(c��-��@�c_銫e�m%�1���� _銡��z`$ h)_���lur �q���_���*�y��j5��5����<�� - �����b���]%s�����}���t˚c �?�z�luvo,iq�-��5�����*v�t�w�_�1�4�@���٥�pg*�x��c�׮ ��_jt - �1���yû��!!� 4����` ��o-ih�[h��k�2mj��]$�#gi��_銨��1�i�v��_q�}*:p��w� _銵�t� i��*�o-�� h(?������u�u9 8 ���b� �1�i�v��_?�4�� i��*�*�.�����[email protected]�sl��h?�z�luz_ �j���o�v��@�>jҵ[y��-�d���,���b�u�z����鶰�-�n�豆drhqj�|u3o)�,��c_銡g�4��d��e���un<��gn6� ��k�1v�� %��?���*��[���p���lu^o*�*�����k�1u(<���q� #�1���[��\f�i��*�|����89x�k�1u8|���qkh��k�1u�xң -���z�lu��xҥ� h ?�������ʟt���}���u�򮒋�l��1���yǚq�˝#�v2i�ah��h�� �2�c/�4��e����z�l�r�������}5�� (�x�[��m �����dci7?�4�ڋi��m�� �r��o���*�yol&�� w���� �u&�����c_�-pj �rw����z�l3u� i����_�kw�kh��8?�z�lu��-#�x���k�1w����c��e���]��?����w�kh��8?�z�lu��-#�x���k�1t����f�v�z0f^e�c�ԋu�k��?����w�kh��8?�z�lu��-#�x���k�1w����c��e���]��?����w�kh��8?�z�lu�[��- �����d x g�m%�3y�i����d�t��� i����_酊��x��4[h��k�1uh|����k8 ��k�1u��-#�x���k�1t4�z�ѹ���5�����ηß� �^���l�y�?-il�m����d6˒x��e��q�����"1�^ ���&к��m*av����ƿ�y7�t�j-��5�����} ���89x�k�1u�ygkv�[email protected]�c_銷'���b���v�� [��p�c.m ������sy���`�i��-��-��@�c_�-�/o �l���g�v��a>j˺g��a�"��a`�q�}*:q��w� _銬o-�m �m�����p�gkv�֐���b���ɩ��i��d���ʺs���ar�����!���^^�&���ŧ�ʱ��ȁ��k���9)�*��8*?��� g49���,�ȵ�������,�ȵ��7zo �qӎ���z�l����s�z�g�v���ro-酀6�r����zզ�����c_逳�p�_j��� 4����` ���sl�>� ��_�kv���tt�i��v��"[ �|��hhkh ?�����i��� zaj����d��f򾔀��w� _逶a������[email protected]?�k�0���;k�-&�kx�ffbʊw���5"�|��x�gn�������5���n�pq�|������ _�m!�|���[h�z�l�b��ß��?�k�1hs��z[� i� _� �,.i�� h(?���&�t�����z���b���[��m ��k�2�\���1x�i�v��&ю�u�brpv���� (�s��:[�����ƿ�l�%�ykkf*�����d�u`��v����ƿ�t� i����_銡��ζ��m �1���r�c��g��l�d�4k zeue�rh�#n��zg����"��b��gk��m �1���u!��ɬ�'�1���w�����c��e���tn<��[email protected][h�����<��ȵk8 ��k�1uo��,pȵ�����zg����"��b�� i����_銻�%���-�*���,pȵ�����zg����"��b�� i����_銻�%���-�*���,pȵ���u7喍.��`�<0�"0���5�e:⩯�kh��8?�z�lu��-#�x���k�1w����c��e���]��?����w�kh��8?�z�lu��-#�x���k�1w����c��e���]��?����w�kh��8?�z�lu��-#�x���k�1w����c��e���]��?����w�kh��8?�z�lu��-#�x���k�1vǔ􁸳��e���r�.�x�"o[�(���<�m ��۠튦��-#�x���k�1v��zg����"��b�=���x��&*�|uث�wb��]��v*�uث�t�������m��gz6*���f*�o�*�������p�g�1�כ������/ҟ~y��;���4�0�c���x��&o� �n��ӊ���qtn*�������cgb��p����q��b��p3����m~��uqt5�q����?n*���]vȗ�-��g�h��k�wb��]��v*�uث�w�� �נɸ��pwl⨸���b��t5�q����n*����쟖*�^�l1wb�k�ت�o�~x��*��8� ����t-~�*��v��*���cf�?�8� �1tv*��@d�z�7تo�r�<�q���i-�b��]��v*�u ?�9�h���ɴ�k�b��⨘>��po���w��1u��k��t��gek��ъ�b�c犫����-�_m�0�3�=�ek���0p�կs�2����9&�bw�b�x>��u�: ue��?,ud�l��tl�ݟ�*��폞*�w���u���a���*��ъ������o�~x�6o�~x�v�q7}�v�>���y~��⨩���tm~�ъ�w���\�ܜuj��ur��]g��'�}8�*��`,��n����]}��$ԫ���yg��h|�!��]w���&㮳�qu!��� �h�����t9���psdd����v*�uث�wb��]��v*�uت o�r��p��� 2� -��,uv�� uwa\����_��emc��d6˒���6��>���w_o��u�8��_��b��휁o�%e���\��[}���s���-���g���� :�,7}�u��|�uֿo��w����ȗ�.o��|���|�gk�n�<�g�e��7s�dkdm�n�c���� z&���-�j׾�c~�ӓkd�vȗ�5k��j���$ԉ��2%� -���bo���4�_���ehd�c�n<�q��m�d�r9�a��@7k���h��m���,r�}�� ���rm�����yg�����'�e��9&�{_���ت�������?*�齜ӝ�� �7���4�堧�t��.����������l�&o�,�n��ӊ���qtn*�������cgb��p����q��b��p3����m~��uqt5�q����?n*���]vȗ�-��g�h��k�wb��]��v*�uث�w�� �נɸ��pwl⨸���b��t5�q����n*����쟖*�^�l1wb�k�ت�o�~x��*��8� ����t-~�*��v��*���cf�?�8� �1tv*��@d�z�7تo�r�<�q���i-�b��]��v*�u ?�9�h���ɴ�k�b��⨘>��po���w��1u��k��t��gek��ъ�b�c犫����-�_m�0�3�=�ek���0p�կs�2����9&�bw�b�x>��u�: ue��?,ud�l��tl�ݟ�*��폞*�w���u���a���*��ъ������o�~x�6o�~x�v�q7}�v�>���y~��⨩���tm~�ъ�w���\�ܜuj��ur��]g��'�}8�*��`,��n����]}��$ԫ���yg��h|�!��]w���&㮳�qu!��� �h�����t9���psdd����v*�uث�wb��]��v*�uت o�r��p��� 2� -��,uv�� uwa\����_��emc��d6˒���6��>���w_o��u�8��_��b��휁o�%e���\��[}���s���-���g���� :�,7}�u��|�uֿo��w����ȗ�.o��|���|�gk�n�<�g�e��7s�dkdm�n�c���� z&���-�j׾�c~�ӓkd�vȗ�5k��j���$ԉ��2%� -���bo���4�_���ehd�c�n<�q��m�d�r9�a��@7k���h��m���,r�}�� ���rm�����yg�����'�e��9&�{_���ت�������?�d�?�8� �1tv*�u/�?��b��1t�v*���w:6�>�9���rizv̍6$a��h��h����pe=tw��!\�q�ą�2 ��8� ����t-~�*��v��*���cf�?�8� �1tv*��@d�z�7تo�r�<�q���i-�b��]��v*�u ?�9�h���ɴ�k�b��⨘>��po���w��1u��k��t��gek��ъ�b�c犫����-�_m�0�3�=�ek���0p�կs�2����9&�bw�b�x>��u�: ue��?,ud�l��tl�ݟ�*��폞*�w���u���a���*��ъ������o�~x�6o�~x�v�q7}�v�>���y~��⨩���tm~�ъ�w���\�ܜuj��ur��]g��'�}8�*��`,��n����]}��$ԫ���yg��h|�!��]w���&㮳�qu!��� �h�����t9���psdd����v*�uث�wb��]��v*�uت o�r��p��� 2� -��,uv�� uwa\����_��emc��d6˒���6��>���w_o��u�8��_��b��휁o�%e���\��[}���s���-���g���� :�,7}�u��|�uֿo��w����ȗ�.o��|���|�gk�n�<�g�e��7s�dkdm�n�c���� z&���-�j׾�c~�ӓkd�vȗ�5k��j���$ԉ��2%� -���bo���4�_���ehd�c�n<�q��m�d�r9�a��@7k���h��m���,r�}�� ���rm�����yg�����'�e��9&�{_���ت�������?��qq����wb�kσ_i�>�u[['�?,u�f*�b��^i�99�(�ď�z|��o�g��4���� ���1g��d���������qtm~x�;v*���f*�m�*����}���z��u����u m��*��z�qtlb��uǧ*��9(��2n3�t�l� |y"��#&�[��]��v*�uت�r�<�1���i<�b����q0}������*�w�b�->�ъ����*�����b����w��c"[`���a g�{�`�����`,�ͫ^�e5;��rmh�����p�}���^t��o�~x�ɾ��⨙��?,u �x������*���g^����<ڇ팈m�%���m �}���t���ъ��qu��o��]7�9�j�����sr��c ��g"[��r/��ӄ5ϛux"n�b�1���b��~�ъ���c�-�\��!�������`����y��l�qz2n:*�ȗ�:��!f�����m�a��[ կ|f����$։��-�jש�,���i�s�dkd[����2�%�if��f�<�����"�y:�휛���}�sp�팀n�%9~����qv>x�!��c ��l�l��o��р��5��6o�ˏ�rm*��c��u�t���1u[o�~x��*���c劫[}����kσ_i�~�u[v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�? ?� ��ɋ�_v*�uث�wb�;�/�n��o���~�p�ባc'��yޕb� ήm"7z����=��řĵ�j�ŷ1u���s�g�ъ����*�����b����w��c"[`���a g�{�`�����`,�ͫ^�e5;��rmh�����p�}���^t��o�~x�ɾ��⨙��?,u �x������*���g^����<ڇ팈m�%���m �}���t���ъ��qu��o��]7�9�j�����sr��c ��g"[��r/��ӄ5ϛux"n�b�1���b��~�ъ���c�-�\��!�������`����y��l�qz2n:*�ȗ�:��!f�����m�a��[ կ|f����$։��-�jש�,���i�s�dkd[����2�%�if��f�<�����"�y:�휛���}�sp�팀n�%9~����qv>x�!��c ��l�l��o��р��5��6o�ˏ�rm*��c��u�t���1u[o�~x��*���c劫[}����kσ_i�~�u[v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�? ?� ��ɋ�_v*�uث�v��)�#c��z��%��,�57f�y$�����jr��<~��g�w�m���%��������ÿ���|#��w�u/�,��0���-'x-��"���y�ne��?a��ff���w����f��j�!�p܊׆�6<�튰m��q~`]��h#����1��k�����u�����������*��ʯ����o�k��������>~i���o��i���y������e��ճ�nq��n*�ϩ�q8�o�n*���u��@k���g�a��@���*���u�pםf*����8��*�u�"[ ���c)�rm.�]��v*�uث�wb��\zb� ���^�&�;a\}�����#劮�pםf*���}8��*�o�~x�z�u0�]����rpψ��x��οٿ��rӛ�&���.5 x��9�f�v=m l�v�8��n1-�3a�f����qtm~x�;v*���f*�m�*����}���z��u����u m��*��z�qtlb��uǧ*��9(��2n3�t�l� |y"��#&�[��]��v*�uت�r�<�1���i<�b����q0}������*�w�b�->�ъ����*�����b����w��c"[`���a g�{�`�����`,�ͫ^�e5;��rmh�����p�}���^t��o�~x�ɾ��⨩w���p6�nܡ`�[�*kb:��jq1檚���i&`��� ���&[ �nj���|u?�c��tm���v��?y�y.��c�q�y�8���c�r$e���re��z�8)�2mn�]��v*�uث�wb��]��v*�u'�9�h�~���s_�����*�m�*����~��w��g瀲�6��c"e�}�l�cv�d��u ���b����ue���1wm��@�ǒ��rra�\ԭ�������ȗ��t����� s�f��ت�e�x��_��b��~��dkl'�gc>hd�>xx#��'eh#�"�v������2%���'y���c煭u�|��5k�y��k��5�n�dkl��q 5�g�jd\����h�� ��@�q���р��42}��ȷn��g&�g�_f)� �c ��n_�~y6�\_ݏ�)x����r[?�96�s�w�`,��f��� ���휓j����quluu���uv�쟞*���.���b���`b�����w�}��v�]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*������2b�w�]��v*�uث�wb��]���h�ɋ���6��&qw�b�k���b���`b�����*��e�1?�v��{/���'�?��f���'��'���ov�i�f��}8��>�d�?�8� �1tv*�u/�?��b��1t�v*���r�g�p1l�z�v���zϲ������d4���y�s���g�n����64�*����gb��p�o��u���u1u;��qu _����u�}���-���q��o�n*���u����p%�m�v*��휁o�$\dd�kx�ث�wb��]��bo��@�ǒ&?�2m'��p���x�&�1t����u�� ue���1u9���qr�w�b�x�����?hdkl�}�!����|,r�v>��9�k�� ��s��i������1uk΃yi���y7�?���0 ����ɧ��'����:���t��,���|ye�y7���~���coi�v�~�vi��8�l|�d�����b�6�lb�[��*��쟖*��tm�lu�o�~x�_�~x�*o��u_��b������w'�'r��ct��1wy�8���_n*��� 8ss��ge5�_o��5*��pq��<�n<�]���ɸ��uh}���9�"���9"�k-z���&�b��]��v*�uث�wb��]��v*����r$t?`d�l���� w���u��u�pw?l������yg�p��� ���m��o�~x�����1uc��*�������g [��q�9 �.jv�la`��l�k|y*e���p���b�� m�luf?��,uu���1u�?h|�%� ����1�42u<,������4�n-z�ɸ蛞�"[ �o�p��?�>xz�7]�l�v���v����1e�w�h�p��ol�ᐏzn�ͪ�&w]���z�8�������5".z �l���~x�s�rm(�����yg�>���[�'\}��q�#����j}�� ��/�?<�b./����<_hdt�-�휛b)���0q�o����yq��i�^��}8��*���f*�i�o�w�p�h|�uko�1u\u y�b��>�ӊ�b��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��yg���s�1w���]��v*�uث�wb�3�� ��^=���a� �sp�)5��d�f�9�)��튽�b]}��w��t�^#�9u�{/����s��_��u���w���>���h�����ԯ��7�ژ�m���2_�9wr�;s�3�rn��ӊ���qtn*�������cgb��p����q��b��p3����m~��uqt5�q����?n*���]vȗ�-��g�h��k�wb��]��v*�uث�w�� �נɸ��pwl⨸���b��t5�q����n*����쟖*�^�l1wb��?�,~֙�=p���o��8��=3�7�q ?�1��s����۱�,�4͍?c����k��qث�t%���1u{o�1ulun��ub��⨼ul�`�ko�1tn*�������cgb�=1ta�g�a�q�����g [���6��(v*�uث�wb��p����-�䉏쌛i� �~�*��� u�h��u{��yi���uno�qtt����/�>x�������cc>h3� t�ݏ�gmz�8)�����jd'�f*���uz��vz}���vm���[��6��0��d�~��z ���z�����گ�t��r��x�kx!���y�ƞ��w���"sh�dgo&y�3_�o0�w���/g�s z�.��j;co�j$.���l�l2��4͈���f*�o��*������>��b��d���[��'犡��g犢���q��f*���,urrqu o�1ukσu�s�����⨫�����5;o�psyu����r���ejq���ȇ��u��,���ϡ�t��<��y".��ӓ-p�ש�m�jv*�uث�wb��]��v*�uث�wb�)>�� rec�h4˚�,p�h|�u[o�1u\us��*��?<�y���.k�;d���'犩]}��t?��-~�ъ�o�r�<���� r�m�� ���d�ǒ�_ݟ�k�4(�0�d���tc�-��wz���_s���"[`�?�8c�c'q���/�8 (�ad[��-��pߘ�h�s����p<��o�o 饣��fx������/u=n��h�pu��8b��<-h���瀶a�^������oc��wm ;��w�w���wy� �ldy�q�p�����p�΃�z�b�a���䚑=d�ae��?,c)�p9&�k�w�`,�� �h|�-ǔ�>�ɸ���ъg5>���rs���m��c�b/�2�\����m���� (�q��xd�,��g$үk�>�u[a�}��u��'犫�k��>x������*���1u��g��u�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]������������wb��]��v*�uث�wp�*�˚j�aߠ��*i�:�����m��z�*���f*�o�*���u����e3�h�g�c?.���l�}��*y:�..c�_�qc������}������8g)f��}8��>�d�?�8� �1tv*�u/�?��b��1t�v*���r�u���/��{-�?fo�8ǫ�^�zxn_�vә��ҵۮ�9���a���6|�<&���oi�u�_�*��]��.��ъ��}���b�w`��oe�f�b[}���qv��u��;q銠2j=z ���u7�9�h���ɴ��c�wb��]��v*��휁o�$ldd�o5ءs��tl`b�7�g犫����o��b�s}��������p�}���u�~�ȗ�/��c�a��x"���} 8sjש�mn�휓r!?��1t,lb�ם*����*�o�~x�e���ˡyn���7o���9���>x��,&h>��h�n`�xd�����(>&_�k�l�}��`#� ���ο�*����?���9��_���w�g�������2����/�� ��,���m�?�c��tm���v��?y�y.��c�q�y�8���c�r$e���re��z�8)�2mn�]��v*�uث�wb��]��v*�u'�9�h�~���s_�����*�m�*����~��w��g瀲�6��c"e�}�l�cv�d��u ���b����ue���1wm��@�ǒ��rra�\ԭ�������ȗ��t����� s�f��ت�e�x��_��b��~��dkl'�gc>hd�>xx#��'ehd �q��ka�.uo̘no�օop�jm�3ճ�-�~'������yyvpu��8b��<-h���瀶ad?e�x�f�#�r��i���՘��z�jƴd�����}su�<��85k��j���$ԉ��2%� -���bo���4�_���ehd�c�n<�q��m�d�r9�a��@7k���h��m���,r�}�� ���rm�����yg�����'�e��9&�{_���ت�������?���tv*�u w���u^�� uss��p��x�/[7�8���u���d�(>��qث�lu�rq��d�gb�9�����eg�g�&�w�;v*�uث�wb�i�����d��fm��]�w?od��*��~x���a����_f*�7�8�*_���u ���b�&�g犱�/�c���?�c7}��3{v_������'�þv�����|<ӿ��[�n�gl\�"�;r��瘞��xr�^.l�se��d7�mόpc%c��z���i��#������ ڞ�{��"���}�������g犣d�'加luw�n�쟞*����*����uf����wh|�u����t����u/:�u�}n*�~�ӊ��>������me���2mj���y�g���"�%�h|�n:�>�rh|�a䈺�?nh�c��cbk�2�#�i�ث�wb��]��v*�u���v*�uث�t�h� �9"��$e�~([��>x������*���g^����<ڇ팈m�%���m �}���t���ъ��qu��o��]7�9�j�����sr��c ��g"[��r/��ӄ5ϛux"n�b�1���b��~�ъ���c�-�\��!�������`����y��w���%��b�؁]���3"#�ٶf�������my��׏"��եs��b9d�����k���e����d� 4<h|�n����sՠ��n5�df]�4�e�|2�1󑠌��i�%޳ �{�-�ȿ&z����0�a� �p��������ֽn�p�~y&�e�a�-�yo����|�i���� (�c'�<�q�돶rn:$u�b��b�2�\���g�he����b���� �n�%����he?�f�<�m���>k.>��4�����v�pw_o��um>��������*�m�*����:�u}���quluث�wb��]��q4���]��v*�uث�wb��]��v*�uث�wb��]��v*������2b�w�]��v*�uث�wb�s��m� im�,~���‚��n o�'|u�6^_]_h����i�ԗ*��h�׈;���gk󖈞�._p��>g��`�˕*;�u�������],��&/��a�t�����-�vh�=r� ���3�?,�h�8�be���#�{��r�2��.pr5k*��`���q�l`?���v�,�����2�ݸ��pn{ t*�<��v���#�?�y��|�t�{>~�˻�3^-��s���n �fw����t�&qq�!��q6����ĵ�g� ����th��� ˣ��� �xc�`1��� �tzt���?1<��j�t"��">����9l�{��êj�d��d�vj/;�~ �s������us�v�?��e�i1�x�g�ˌ(5k*��y��j�t��z d;[email protected]�x��j�u��`�s���_��պ��v�?��e�i1�x��y�aryu;*�x��j�u���ߥ,��&/��w��.�����b���u�!.����^#���uh�����,������uw��.�����b���u9|����ss�4�����u�����g�������u��.�����b���u�y���}�n����?��g�����t�$�:���rb��ŏ`59\� ,�x0�q1�#y��p~m[\iy�q�� mk'�[email protected]�@۶`h���뽤쑧�2c�2�����x>\�����$��5f��� ˟�t������u��|��wk/�i��j�t�2<�m/�;6� ���j����,�a�r�b;�4���޷��o�֧�� � �4��a��� f�i���'����|0�?�p�����?�`�s���_��՛w�w��.�����b���w�����],��&/��w��.�����b���w�.�jy�l_�v*��0п��g�i��y o�a������k-���/��&���x>\�����$��5b�/�=b]u;"��g�5b����.��uk*��y��j�[�������y�l_�v*�/���>�����v*�^z��#��[email protected]��d�v*��v�?��e�i1�x����?����}rϊ�&���� ��l���t��m>[��p�� {���bv��/�a����x� �_�>�l��v�?��e�i1�y�f������� i�-ݽ�!�tfc�ĵ>y���~j|b��v e.�[�����zץ֠o��e|��z�g�h!�g�b9!*$ؐ��p�r7i���n���0k.��m���9 !s�q޽3���w�n]q ��x� }om��嫘�x�k. �f �l� g�����.a�yt���_�vet��z d3jvt���պ������],��&/��w��.�����b���u)<�ly&�dg��g�5b����bt����v*��v�?��e�i1�x����dt�$����v*�?:��o���1��x����.�����b���v���]q�uk*��y��j�t��z g��[email protected]�x��j�u�`�s���_��պ�0<�ƒt�������ui<��c��d�����u[�v�?��e�i1�x����ߥ,��&/��q�h_�r�����欅7ڰ�����������փhw��.�����b���v-�����i�d��ז�73)�5�us���ҙ������ދ��gw�g�c��/ �ry��#%�� n� k ?��l�o�k��>=o��;�ob���?u��$o��敄�w�5��m� b�p���֮ez�,�q��8��vw岉������`�s���_��՛�w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���u'�!井��^#���%�'ee���tq:��g����5d���|��wk/�i��j� ry�@��mnȏ����j�w�����ڥ�#�^c���u3� �!�yp���g�5b���ǘ�mnȑ��"?��j?:��o���1��x�m��e��?���պ�7�<���r˗o��?��s_8�hcjʃ�^#���u��}o�5;"���vd�d�o>yz!��; }�#����2�|ߡ�iy�d�v*��/��k�����հ��7g�/û�vb�7��x�r d�)暝���յ�x�痕}3�yr���g�5b�i�-2�; ��g�5b�]w�3˶v�r���̻,i�c}q8�fv��s��zu���ˆq�$m�7 ��?:�1��:k�m-�[�'�$�)%o.k�3]ظ��s�.f�m���x�{�8���7e�o���b�n�ey��qgn?75��/id2��8��a�ֆ�)�~�w�%e�i��y�z�����/����a�/��x��������^#���v��t"y jʇ��?��uo?�u��yt�����5b�#������$g�5b���ǘ� n���^#���v��ח�}n��/��x����Ԭ�w�z#���ug�痤^ �y�����ud~u�!<�s��b#���v��1䚝���պ�<���_h�v\�>��պ��κ g��[email protected]�x��j�[���_��5;#o�x��j�]���k�vb����պ��hd��%en��d�v*��|���jvd��d�v�<���}��; ���v�e�<�ly��dg��g�5d���|����'e�����x (�z�s�p�mj��/��x no;hi���1��y&�e�/���vb�?�#���v��� yjνވ�欋u���~^�qmnȟ�\g�5a,"x��o�n��h�&�w����u�p����&��-v_>e�{buyŏl7?�|q?�?�ze���;�kk��#����`��d�|h��n�н&r?�[������`�s���_��ՙn���|��wk/�i��j�]� ˟�t������u��|��wk/�i��j�]� ˟�t������u��|��wk/�i��j�]� ˟�t������u��hhs\èzm*!)l��݇bz�yg�k��ҝvx�s�u,�k�z�ky�5˘m�yzdi� �9������g�ou�7f~\�$~�o�~�������],��&/��6o��x>\�����$��5b��������y�l_�v*��x>\�����$��5b�m�- �!�y�����ve�e��ct����v�y�� ˟�t������(r���ǒjvd�d�v*�?>yz!��k �"?��]� ˟�t������ui���y��da�����u��m/��nˑޟx��j�yg�k�m3ɵ 0��g�5` �;7/�<�?���?��?��$��^z��#��[email protected]��x��j�v��mc�5;"?�"?��]�9��k��/�g�5b�c� ������պ��頹井��^#���%�'e��/��gs��{}b?��k�5���a��}n��/��xx��u�d<�r� ����vd�������辛jva�o�g�5a d��/і���������,��/�n�����g�5b�w�z ��ev��g�5b���]��; ?�"?��no;�i��<.#���%�%��ח�lm������v�\؝��^���se�0x.l�d��?��si-��(�s���ڸ�sy�ˮ8��es�/��y�l #�/�{��>�sh�p�]� u�)���!^����˒2&1�<�d�ϋm/�ѣ�[email protected]�5u�v5�#�sէ�� p��a�_c�?�o��g��k�{w"�� ta�����ߗ�ab]���� ��ߗ�s�jvc����՘@2�`���$��4�!�"r��sȏ����|sw>�� �̋��o�������n�^-n̆��du���y پ�~v�khzo�nl⺆���hev�e �wa���ӌ�č���2 |��g��^ hvxdq,j 0#f�3�n� �?p���k� �fh�΅gsq���idޤȯ���c^�����c�(ƹl�ӓ��-�~x��;��d��j�xg"���bc�jvt;����xz׿�|�0�jvd�����j�yĵ�v�"��s����v����������#���mj�ͼ^e�ʃe˥>��հ�sx<�)�u 0��g�5`m%��)溝��^#���m*�ϟ^������ҟx��j�!b��a��}j��/��y�#�m� �a�yp����vi�q|���_l�\����x��󞂇�jv`�x��jȷ�o�-b]u;"��g�5d�u�<���r˗j}b?���ksκ g��[email protected]�x��jȇ��9�2�i����?��$ժ?=�z��k �"?��_� ˟�t������ujo:�i���1��x�����g��?���պ��������y�l_�v*�'�� �$�����պ��ϟ^�p}r�����j�w�����],��&/��s���_��5;#o�x��j�[��~^�q}n�����j�w������],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��`��ߚzu����5�77/�euz��l��e�u/y��g�g7�a��'�k���u* ��m���9&d!���r�>_6��_dt�������x>\�����$��5fc�w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���w�����],��&/��w��.�����b���v��`ys���_��պ�o�����2b�w�]��v*�uث�wb�g�ʒy�ik$�$s!= f�Ÿclu�_*��]�ֶ"k�l���� �x 1��lut�pym�]2�ri�{�uo���)ղ���qux?*���n��\*���^t����ni���p�g�ʊ��[email protected]?� �ϟ���i�v��� �j����|9�\����g�1�32p��z��8��*�r�����i��on��s0ϲ:���?�,�0�k�m� ��t� �"�]�e|s��xi�����"<�m���"���m�[email protected]i�w���,����_����^d����� �ݞ9fod�d� ��g�$g �������g�i�u�p��a~�jqv�h�nm �>�to��d��������-�?���ӷ ?�w�m:�8�����)ղ���qwʞ��[-���u����)�@��ۊ���ʒ7&�-�=��n*��t�����o��������˦[�;���u|��w�q}:?���uk�t�����o����k�a�5!�l��������>w�q}:�8�����)ղ���qv�������-�?���uu�*���i�z�8�����)ղ���qv�������-���w��[������[email protected]�oyh��2���qc_򧼥�v����qv��^[��o�g��%.nfd�1�*7�ח�a)�������|(�sy� �\\r��j����w�-ɵ�5\�q�� y�y3����� �*{�_�l����ܛ���s�r��e������=�/��[���n*��s�r��e������=�/��[���n*��s�r��e������uyb04���ro�)�,t�ro�?ۊ��=�/��[���n*��g��sn���s�)�,�e�'����������t}�ud_��u���l������o�ig�`#��\��^[email protected]t���k�e�encl� ּ�uoʿ,0 ����v��o�he#�`p|�qm���ʒ�o��o��� ���#�����i�k�tc"�=��n*ܿ��v�&����q�t�^1�4��w)��/*�t�~]k��qug���â��@a�'[�7��$ǧ���'noʏ �ɧ@�x�*�����m �k���} h�f �4qsj���b��o��s�&�g�5k_�����֟du=��l�z?0o(~h�_�au��� ku,��jd��]�t���g��r�|�w<�>�c�j�f����f�n�����vhug��ool��ٌ�%�e�1�rz{�y��=�_ʏ �c.�nn����r����,��w���t��ʨ��m�1�x�n*�oʏ ȼ_n��ۏ�⭏ʿ,a�an�gq_��)��4�z��������'�����q~r�v*�zl�h�ۊ�/�'�e5�m���ۊ�/�_�t�qu$���75�-�x���u|��w�q}:?���u�~s�z!�4��_��zo�o*���m�����wi�s�yӡ �㊭����tg�� �ۊ�_�_ ma&�s��_�*��s�t��qu8�(���m�><�]/�?���m���ۊm��ty^!�4��w�qc_�|����??ۊ�oʿ,8*�t�qm�����)����n(j_�_*�c&��o��qu���p��s���6���b<��`�_���?-��lv�z�9 @k���u��lo�j���7��n���*��<��q<��l���*{�_�l����ܛ���s�r��e������=�/��[���n*��s�r��e������=�/��[���n*��s�r��e������=�/��[���n*�m�o�kgæ��:�dhqmŗx��g�z���˗���i�:�z��c� ���s �����t�����o���c���s�r��e������=�/��[���n*��s�r��e������w�wn����6���>tv,�e�'��� �oyk�����?ۊ���o�h��`��y'��$<�m�'ǐ���oyk�����?ۊ�g�s�x�ӡv����_������1�x�n*��uya�vӡ ��ml_��u�������n(j_�o*�k&�#��]�g��sn���k�u'�y���`����qv���򼣋�����⭧�w�]:n8�ַ�/�y�c���ǐ���~t�^a���=�⮏���ӡv�mk�r�u�;i���n(t?��y?���s��ʱw��`�e��us~uya�'n�m�ê�'�g��_n����t_��v�r=6��n)���ʬ���`.;���p� ��k]: �? t:~pyme�-�>�¯2�'�'忖� ��j��[?) ��ؙ�3��{3�s�d��hx�st��i�\~i�����(ӓ��x����u��n���}��03 a�ʽ�^8��~n�u�k.�0'� a�3s{#���c�����~r�-�]6���r]�aq]�ɍ㑉�iȼf������js��u*�_��u��m6o��ny.����c�_o�]�24��4lv"�hiy:gw��}fh � ����m81�������/��h"�)_s�kǝ>�ծmю_����wg�w{]�q~m�u�q4��b�?�n`��-h����%����ʗ�$�m���au���>q�4�]�ʿ,a�aa�neve�k�x�1�z��n_ʏ �(�t ����_�*��?�o��(������n�x�n*�ߕ~x`aӡ ���m��*|� �t�qb���/*r��2ߕk^?ۊ�i�u����z�8��_ʿ,(i�?�� m�e�fngl�-���quw���â��@a���i?*���*��:|8�m(����i���׏�⪒~t�^e��txq�6��*|��t�qb�?(��)��l�������s�r��e���⪱�ty^!�4��w�qu��ryvsw�`$������s�r��e���⪱~s�z!�4��_��vi�e�i�������uo���)ղ���quh�)��dzl� ���r�q�vs��� �w�qu�򧼥�v����]�*{�_�l�����u�򧼥�v����]�*{�_�l�����u�򧼥�v����]�*{�_�l�����u�򧼥�v����qv�z�[��'.�\��%�9x5y0}1���^x�r}:`)r���";��1�2>j򧼥�v����4;�t�����o������oyk�����?ۊ��t�����o������oyk�����?ۊ��t�����o������oyk�����?ۊ��t�����o������oyk�����?ۊ��t�����o������oyk�����?ۊ��t�����o������oyk�����?ۊ��t�����o������oyk�����?ۊ��t�����o������oyk�����?ۊ��t�����o��������v���qv1���\��lu����wb��]��v*�uث�wb��]��jo�~gw�?�>f]m��p �b�s�;[}��p9�� �ov gg�<�x��s6������v�a�/���g,w���3��b��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��xo��e���(�ҩr�h9�s��vݪh��7qg>]�������!�`d<�4$oq r�ƽ����=�k���.u�����l���x�(t~i��~hh�îu>�ȝ\}���3}/c��q���/���y�쿭/��<�l�d�u࿔�������3�9d��r ��ɶ�۷ |��n6.e�[�iaw�yj��<�=i�;k2t� 枡��[email protected]�/���, ���v�a�b^� �d�����*$�����c�w��'r�'?'�i��?�#9l�y����"�v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�w�[email protected]�w?�z�*�uث�wb��]��v*�uث�wb��z�쟑��אt뫽r��nb��d�h����zs���w�^;�;j��,8�:��o�.�n��t���i/�db��q�tmݥ�f;���_��$����z'��o�c������r����#r��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��s�r���?�v���y?�e���ޙy��q�im�u5�6��%�!1)�lks����0� o����������~_�y��ԉf��!n�r������癿�7��v��s������̽�8�%ث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث����gr��y�9����x}�'ȼgcc{�m#g:m��ȯ"ij�i����9�� � ���c�� �������wk=���:���<lp�!�o�]�ma��me�}��z-�$t%\ ��f��2|ܸy����t�1s]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�u�_���ϟl�q�1�`�*�m���9���������zo�5m_����6�ٴ�q�^ܣ,������n�9�9*���u��������]ޤ���p�d�8�t��x 꽘���_sfo���p��5���e���{/�k�m�$�1;x/�5���^n��'�㘑b�ư��9������~�2�д�fo&�%֙y ��ei��l�n�k z���[��)�c�i�w�w��1�g�;�$��h�iq7�ko��rs��w�d�rn>~o�t����ğ���o�����yr]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�? ?� ��ɋ�_v*�uث�wb��]��v*�uث�wb�0�#����#<�is�\����r���nժ���^��g�q����9�`���ǘ�ŗ��gso�_�!�g}�a���o.,x�o �ڧ�2�� cko�51��|h)�6iqh���|�.�]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb�=������啭���[km8�3�z ml�;�����0d%٫$8����̞��u����3k����p�k_���_�#��u����0)�?�>�ڼ�d_������^�}r�.羑d,���[email protected]�\���jcz 1��@v���ǜҳ�nv*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�y�f}oj��#`�s ��� �zl�h���ac!b�q�u����|ķ�e��x�-j��z�ώwq�.�-xof]䟛�#2��x\ߒ^l����mx��/�22�$к�j���w�4�clf|���ð6 ���̟��w��l�)�?�>�ڼ�ku���;��g����ۇw��iq�d����&��c�bj��j)e�6px#���ez��3����=�� �v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb�(���x��&*�|uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث��� �� ��_���c����=��j����:ֆ��i�\�z[?�b�ބb��oq����v��cq�~��0�u�/-z^>��g*ot#_n��8#�z��۾k�3�����|!>�1�t qs5�r<�#�4�����@o����9?�/�^�?��gj�<��ogl��v�g�ᓐ�1v��轝�9j� '�_&����o���g������"3g�������a�?�n�]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��^q���\��lu����wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�w���a������%·���{��՗�, ���eд�h� /m���76�[email protected]��� ��0;pޣ'��(r �a����z z��z���r"1�v>�9i�h*hky�3�~v�gs,:}��ş��8�f��у?g��銼g�ros�v���{[��ēf�?t��f�q�{�ηٿ��~��k��/��ӿ�/���oh?�k�l�$�0;v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��yg���s�1w���]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��]��v*�uث�wb��x���.<������9�i*p��o�n���k�9edg�� ljs�4�˯�m.� =n�;x"/h�����t�